Navigation Links
New Temperature Control Products Announced by Oven Industries Inc.
Date:5/17/2013

Mechanicsburg, PA (PRWEB) May 17, 2013

Oven Industries Inc. announces a new temperature control products with ramp/soak capabilities. The 5R6-900 temperature controller has many user-friendly benefits. Contained all in one enclosure, the device can be plugged into the wall as a self-contained temperature control system, which has its own power supply. This distinctive detail makes the device unique, as well as highly convenient for users.

The controller can also be used universally, which allows the user to use the device wherever they are located. As a solid state MOSFET bidirectional compact temperature control featuring an internal power supply, it is also capable of loading currents up to 10A. The compact size, as well as the isolated communication port, makes using the 5R6-900 benchtop temperature controller a breeze.

User-friendly and PC programmable, the unit easily connects to a computer through the electrically isolated RS232 communications port. The computer can be utilized as a connector and can stand alone, once the desired parameter settings are in place. These settings are kept in the non-volatile memory.

Great for usage in universities, science laboratories, PCR research and any businesses that specialize in temperature control. The product features an easy-to-read digital display for controlling functions, including adjusting output voltage and setting the desired temperature. Complete with an auto output shutdown if the sensor is opened or shorted, the unit also includes high, low and no alarm settings.

Oven Industries has many unique options for customized, industrial quality temperature controllers and sensors. All products are designed b
'/>"/>

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

Page: 1 2

Related biology technology :

1. New PID Temperature Controllers Announced by Oven Industries Inc.
2. New High Powered Temperature Controller Announced by Oven Industries
3. New Electronic Temperature Controller Announced by Oven Industries Inc.
4. New Temperature Controllers Announced by Oven Industries Inc.
5. New Temperature Controller 5R7-001 with Easy to Use Software by Oven Industries
6. Groundbreaking New Incubator Technology Allows for Temperature Control at Ambient Conditions (20 to 25C)
7. New Digital Temperature Controllers with Ramp/Soak Capabilities
8. Burns Engineering Announces Expanded Selection of Miniature Temperature Sensors
9. Cole-Parmer Offers New Oakton® Temp 9000/9500 Benchtop Temperature Controllers
10. Breaking the final barrier: Room-temperature electrically powered nanolasers
11. PolyScience to Exhibit Its Latest Liquid Temperature Control Solutions at Pittcon 2013
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/19/2014)... Calif. , Dec. 19, 2014  Roche (SIX: ... of Bina Technologies, Inc. (Bina), a privately held ... , USA. Bina provides a big data ... generation sequencing (NGS) data. Bina,s proprietary on-market Genomic ... and academic researchers to perform fast and scalable ...
(Date:12/19/2014)... December 18, 2014 BioPlus ... leading specialty pharmacies, has an expanded team of ... pharmacy consultants for prescriber offices in their regions, ... , “We have a variety of Regional Pharmaceutical ... those specializing in hepatitis C help prescribers understand ...
(Date:12/19/2014)... 18, 2014 Reports from CDC ... States suffer from one or more chronic health conditions ... Medication can address some of these diseases, but may ... many sufferers face. While implanted nerve stimulation devices today ... whole nerve, which can induce side effects. , ...
(Date:12/19/2014)... Diego, CA (PRWEB) December 18, 2014 ... a limited time special on Sartorius Biohit products ... Free on mLINE pipettes, Picus Electronic Pipette Trade-in Program, ... by Health and Safety officers around the world. They ... manual pipetting. Other features include:, ,     Full ...
Breaking Biology Technology:Roche acquires Bina Technologies and enters the genomic informatics market 2Roche acquires Bina Technologies and enters the genomic informatics market 3BioPlus Specialty Pharmacy Expands ‘Regional Pharmaceutical Care Liaison’ Team 2BioPlus Specialty Pharmacy Expands ‘Regional Pharmaceutical Care Liaison’ Team 3Draper Wins GSK Funding for Smaller, Smarter Implantable Devices 2Major Pipette Distributor Pipette.com Announces Sartorius Year End Specials 2
... BioMed Realty Trust, Inc. (NYSE: BMR ), a real ... Science Industry®, today announced financial results for the third quarter ended ... Generated record total revenues for the third quarter of ... in 2009. Increased rental revenues for the third quarter by ...
... to develop relatively advanced tools after their brains evolved a ... that investigates why it took early humans almost two million ... axe. Researchers used computer modelling and tiny sensors embedded ... humans needed in order to make two types of tools ...
... New Mexico, NOVEMBER 3, 2010Scientists at the U.S. Department ... Laboratory have fabricated transparent thin films capable of absorbing ... area. The material, described in the journal Chemistry ... transparent solar panels. "Potentially, with future refinement of ...
Cached Biology Technology:BioMed Realty Trust Reports Third Quarter 2010 Financial Results 2BioMed Realty Trust Reports Third Quarter 2010 Financial Results 3BioMed Realty Trust Reports Third Quarter 2010 Financial Results 4BioMed Realty Trust Reports Third Quarter 2010 Financial Results 5BioMed Realty Trust Reports Third Quarter 2010 Financial Results 6BioMed Realty Trust Reports Third Quarter 2010 Financial Results 7BioMed Realty Trust Reports Third Quarter 2010 Financial Results 8BioMed Realty Trust Reports Third Quarter 2010 Financial Results 9BioMed Realty Trust Reports Third Quarter 2010 Financial Results 10BioMed Realty Trust Reports Third Quarter 2010 Financial Results 11BioMed Realty Trust Reports Third Quarter 2010 Financial Results 12BioMed Realty Trust Reports Third Quarter 2010 Financial Results 13BioMed Realty Trust Reports Third Quarter 2010 Financial Results 14BioMed Realty Trust Reports Third Quarter 2010 Financial Results 15BioMed Realty Trust Reports Third Quarter 2010 Financial Results 16BioMed Realty Trust Reports Third Quarter 2010 Financial Results 17Stone Age humans needed more brain power to make big leap in tool design 2Scientists produce transparent, light-harvesting material 2
(Date:12/11/2014)... 2014  Data Sciences International (DSI), the global ... new series of digital telemetry implants to meet ... series, part of the PhysioTel™ Digital platform, was ... physiologic data when incorporating functional endpoints into repeat-dose ... toxicology studies has evolved from short ECG strips ...
(Date:12/10/2014)... DIEGO , Dec. 9, 2014 CIE ... collaboration catalyst that provides the connective tissue that enhances ... enabling them to easily share client-level information; earned a ... to expand to organizations serving seniors aging in community ... Diego" partner on December 11 th 4-6p. ...
(Date:12/5/2014)... , Dec. 4, 2014  Tute Genomics, a leader ... million in Series A1 funding led by UK-based Eurovestech. ... participated in the investment round. "We are ... community adopts next-generation sequencing and seeks new approaches for ... Reid Robison , MD MBA, and CEO of Tute ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... You don,t need to spray weedkiller to remove the ... with either boiling water, steam or flaming will dispatch even ... a new PhD project from the University of Copenhagen. ... is important that each treatment is dosed correctly. Basically, ...
... Johns Hopkins scientists have engineered cells that behave like ... on one or more unique inputs. This feat, published in ... eventually help researchers create computers that use cells as tiny ... in the Department of Cell Biology and member of the ...
... BETHESDA, MD May 30, 2012 The Genetics Society ... six graduate students and seven postdoctoral researchers as recipients of ... Each of these early-career geneticists receives a $1,000 travel award ... in a laboratory course of their choice that will enhance ...
Cached Biology News:Blanch your weeds 2Training cells to perform Boolean functions? It's logical 2Training cells to perform Boolean functions? It's logical 3The Genetics Society of America announces DeLill Nasser Travel Award recipients 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: