Navigation Links
New Publications Show Noninvasive Magnetic Resonance-Guided Focused Ultrasound to be a Potentially Safe, Effective Pain-Relieving Treatment for Bone Metastases
Date:12/2/2008

TIRAT CARMEL, Israel, December 2 /PRNewswire/ -- InSightec Ltd. announced today that new publications show that Magnetic Resonance-guided Focused Ultrasound (MRgFUS) with the ExAblate(R) system has the potential to be an effective noninvasive pain-relieving treatment for tumors that have spread to the bones (bone metastases). The results of a 31 patient study appear in the November 11 online issue of Annals of Surgical Oncology, while data from an eleven-patient subgroup analysis of that study were published separately in the October issue of Radiology.

"The increasing longevity of the population along with the rise in cancer incidence during the last decade and ever-improving treatment outcomes for primary cancers contributes to the growing number of patients living with metastatic bone disease," said Boaz Liberman, MD, Head of Orthopedic Oncology, of Sheba Medical Center, Tel Hashomer, Israel and lead author of the 31-patient analysis. "Increasing focus on cancer patients' quality of life has led to a search for effective pain-relieving treatments with fewer short- and long-term side effects. These preliminary results suggest that the ExAblate(R) treatment using MRgFUS has the potential to provide a safe and effective noninvasive treatment for patients suffering from painful bone metastases."

Of the 25 patients included in Dr. Liberman's efficacy analysis, 72% (18/25) experienced significant pain relief, with 36% (9/25) reporting no pain at three months. More than half of the patients (52%) reported substantial pain relief at the follow-up visit three days after their treatment. A majority of the patients also decreased their opioid and non-opioid analgesic intake following treatment. No device-related adverse events were reported.

In subgroup analysis, researchers from Mount Sinai Hospital in Toronto who participated in this study concluded that ExAblate(R) may be an effective and safe trea
'/>"/>

SOURCE InSightec Ltd
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2 3 4

Related biology technology :

1. ISMPP Applauds AAMC Clarification on Ghostwriting Versus Transparent Writing Collaboration in Scientific Publications
2. Industry Executives Finding Value in Shift of Scientific Publications
3. BioTrends Releases Two Publications - TreatmentTrends(TM): Nephrologists and TreatmentTrends(TM): Renal Dietitians - Highlighting Market Trends for Renal Anemia, Hyperphosphatemia, and Secondary Hyperparathyroidism
4. Industry Executives Finding Value in Shift of Scientific Publications
5. Noninvasive Medical Technologies Helps Make Young Tennessee Womans Wishes Come True
6. Masimo Initiates Limited Release of First-Ever Noninvasive and Continuous Hemoglobin Monitors
7. Carnegie Mellon MRI technology that noninvasively locates, quantifies specific cells in the body
8. BugLab Launches Noninvasive Biomass Monitor for Continuous, On-Line Measurements
9. Biocept Launches Noninvasive Prenatal Rh(D) Diagnostic at Annual ACOG Scientific Meeting
10. Masimo Announces Continuous Noninvasive Total Hemoglobin
11. Masimo Launches Patient SafetyNet and Showcases the Rainbow SET Upgradable Noninvasive Monitoring Platform at 2007 ASA Annual Meeting
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:3/27/2015)... NEW YORK , March 27, 2015  Peter ... in Biomedical Science for his pioneering work on how ... the components of a regulatory mechanism that cells use ... proteins. Dr. Walter is a professor of biochemistry at ... the groundwork for treating a range of human diseases ...
(Date:3/27/2015)... March 27, 2015 WuXi PharmaTech (Cayman) ... R&D capability and technology platform company serving the ... today that an Investigational New Drug (IND) application ... rheumatoid arthritis has been accepted for review by ... In September 2012, MedImmune, the global ...
(Date:3/27/2015)... Buffalo, New York (PRWEB) March 27, 2015 ... of the 2015 application period for 43North - the ... cash prizes, including a grand prize of $1 million, ... attracts entrepreneurs from around the world to compete for ... into funded enterprises in the Western New York region. ...
(Date:3/26/2015)... San Bruno, CA (PRWEB) March 26, 2015 ... organization (CRO), announced today several management and executive ... role of Chief Financial Officer (CFO) and member of ... Vice President of Business Operations, and Sue Dowden will ... Tony Taricco, co-founder and current Chief Operations Officer (COO), ...
Breaking Biology Technology:German-born cell biologist Peter Walter wins the 2015 Vilcek Prize in Biomedical Science 2German-born cell biologist Peter Walter wins the 2015 Vilcek Prize in Biomedical Science 3Investigational New Drug Application for WuXi MedImmune's Monoclonal Antibody Accepted for Review by CFDA 2Investigational New Drug Application for WuXi MedImmune's Monoclonal Antibody Accepted for Review by CFDA 3Governor Andrew M. Cuomo Anounces Launch of Year Two of World's Largest Business Idea Competition and Opening of New Incubator Space in Buffalo, New York 2Governor Andrew M. Cuomo Anounces Launch of Year Two of World's Largest Business Idea Competition and Opening of New Incubator Space in Buffalo, New York 3Governor Andrew M. Cuomo Anounces Launch of Year Two of World's Largest Business Idea Competition and Opening of New Incubator Space in Buffalo, New York 4Governor Andrew M. Cuomo Anounces Launch of Year Two of World's Largest Business Idea Competition and Opening of New Incubator Space in Buffalo, New York 5PRC Clinical Announces Key Management Appointments and Launches East Coast Operations 2PRC Clinical Announces Key Management Appointments and Launches East Coast Operations 3
... -- Engineers at Ohio State University are developing a ... same material found in pencils. , Experts believe that ... graphite pencils -- holds the key to smaller, faster ... could enable new kinds of electronics. , Until now, ...
... March 31 Alseres Pharmaceuticals, Inc. (Nasdaq: ... of the Company,s independent registered public accounting firm ... explanatory paragraph regarding the Company,s ability to continue ... NASDAQ-traded companies to publicly announce if their Annual ...
... after heart attackAUSTIN, Texas, March 31 /PRNewswire/ ... Austin treated the first patient in the world ... test the effectiveness and safety of administering adult stem ... heart attack. Dr. Roger Gammon, a cardiologist with ...
Cached Biology Technology:Researchers find better way to manufacture fast computer chips 2Researchers find better way to manufacture fast computer chips 3Alseres Pharmaceuticals, Inc. Complies with NASDAQ Rule Regarding Recently Filed 10-K 2Alseres Pharmaceuticals, Inc. Complies with NASDAQ Rule Regarding Recently Filed 10-K 3Heart Hospital of Austin First Site in World to Test Efficacy of New Adult Stem Cell Therapy to Treat Damaged Heart Tissue in Phase II Trial 2
(Date:3/12/2015)... March 12, 2015 The mascots of the ... Hospital, part of Wake Forest Baptist Medical Center. They ... the 2015 ACC Men,s Basketball Tournament. Young patients enjoyed ... and getting their autographs. Brenner Children,s Hospital ... is the only children,s hospital in northwest ...
(Date:3/11/2015)...   The Sync Project™ today announced ... and harness music to improve health. The platform ... measurements of physiology, enabling the study of the ... populations. It is designed for medical and health ... studies and accelerate the discovery of the clinical ...
(Date:3/10/2015)...  NXT-ID, Inc. (NASDAQ: NXTD ... authentication company focused on the growing mobile commerce ... been named the "Number One Best Tech Gift ... Modern ( http://www.rethinkmodern.com/ ) is a web magazine focused ... that have a unique function or design.  ...
Breaking Biology News(10 mins):Introducing The Sync Project, a Global Collaboration Harnessing the Scientific Potential of Music for Health 2Introducing The Sync Project, a Global Collaboration Harnessing the Scientific Potential of Music for Health 3NXT-ID's Wocket Smart Wallet Named Number One Best Tech Gift for 2015 by Rethink Modern 2NXT-ID's Wocket Smart Wallet Named Number One Best Tech Gift for 2015 by Rethink Modern 3NXT-ID's Wocket Smart Wallet Named Number One Best Tech Gift for 2015 by Rethink Modern 4
... MADISON, WI, SEPTEMBER 21, 2009 A new ... , documents the history, science, and applications of tall ... increasing role in protecting soil and water and enhancing ... from around the world who address an array of ...
... after plucking the fossilized tooth of a new human ... team of scientists today (Thursday, Oct. 1) announced their ... Ardipithecus ramidus , which they say revolutionizes our understanding ... female skeleton, nicknamed Ardi, is 4.4 million years old, ...
... African bees were accidentally released in Brazil in 1957. ... at the Smithsonian Tropical Research Institute, began a 17-year ... to native bees than changes in the weather and ... , Scientists feared that dangerous swarms of Africanized bees ...
Cached Biology News:Tall fescue's future in agriculture 2Ardi displaces Lucy as oldest hominid skeleton 2Ardi displaces Lucy as oldest hominid skeleton 3Ardi displaces Lucy as oldest hominid skeleton 4Ardi displaces Lucy as oldest hominid skeleton 5Killer bees may increase food supplies for native bees 2
... Mouse polyclonal antibody raised against a ... FES (AAH35357, 120 a.a. ~ 250 ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: