Navigation Links
Neurocrine Biosciences Reports Third Quarter 2008 Results
Date:10/28/2008

ces with respect to the Company's clinical programs include, but are not limited to, risk that the Company's elagolix Phase II clinical trials will fail to demonstrate that elagolix is safe and effective; risk that preclinical data will indicate that urocortin 2 is not suitable for further clinical studies; risk that the CRF1 receptor antagonist candidate's Phase II proof of concept clinical studies will not support further clinical studies; and overall risk that the Company's clinical candidates will not proceed to later stage clinical trials. Risks associated with the Company's indiplon program include, but are not limited to, risk that indiplon approval and subsequent commercialization may be indefinitely delayed or never accomplished. With respect to its pipeline overall, the Company faces risk that it will be unable to raise additional funding required to complete development of all of its product candidates; risk relating to the Company's dependence on contract manufacturers for clinical drug supply; risks associated with the Company's dependence on corporate collaborators for commercial manufacturing and marketing and sales activities; uncertainties relating to patent protection and intellectual property rights of third parties; risks and uncertainties relating to competitive products and technological changes that may limit demand for the Company's products; and the other risks described in the Company's report on Form 10-K for the year ended December 31, 2007 and report on Form 10Q for the quarter ended June 30, 2008. Neurocrine undertakes no obligation to update the statements contained in this press release after the date hereof.

NEUROCRINE BIOSCIENCES, INC.

Condensed Consolidated Statements of Operations

(in thousands, except for per share data)

Three Months Ended Nine Months Ended

September 30,
'/>"/>

SOURCE Neurocrine Biosciences, Inc.
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6 7 8

Related biology technology :

1. Webcast Alert: Neurocrine Announces 3Q 08 Financial Results
2. Neurocrine Biosciences to Present at the Oppenheimer 19th Annual Healthcare Conference
3. Neurocrine Biosciences Announces Conference Call and Webcast to Present Third Quarter 2008 Financial Results
4. Neurocrine Biosciences to Present at the UBS Global Life Sciences Conference
5. Neurocrine Biosciences to Present at Thomas Weisel Healthcare Conference and the NewsMakers in the Biotech Industry Conference
6. Neurocrine Biosciences Reports Second Quarter 2008 Results
7. Neurocrine Biosciences Announces Conference Call and Webcast To Present Second Quarter 2008 Financial Results
8. Neurocrine Biosciences to Present at the 2008 Citi Investment Research Global Health Care Conference
9. Neurocrine Biosciences Announces Conference Call and Webcast to Present First Quarter 2008 Financial Results
10. Neurocrine Biosciences Announces Conference Call and Webcast to Present Fourth Quarter and Year End 2007 Financial Results
11. Neurocrine Announces Appointment of Kevin Gorman, Ph.D., as President and Chief Executive Officer
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/16/2014)... -- BCC Research reveals in its new ... the global market for stem cells is expected to ... five-year compound annual growth rate (CAGR) of 13.6%. The ... growth projections of $2.2 billion in 2014 to $3.9 ... Unlike other potential applications of bioscience, stem ...
(Date:9/15/2014)... drives classical phase transitionsthink solid, liquid, and ... the temperature drops. If phase transitions occur ... mechanics reigns, subtle fluctuations can dramatically transform ... U.S. Department of Energy,s Brookhaven National Laboratory ... frigid landscape of absolute zero to isolate ...
(Date:9/15/2014)... , Sept. 15, 2014 ... on revolutionizing the treatment of cancer through the ... cells, announced that, together with the Asbestos Disease ... Cancer Institute New South Wales (NSW) Premier,s Award ... four recipients are the hospitals that will be ...
(Date:9/15/2014)... a patient has sepsis, a life-threatening condition in which ... often too fast for antibiotics to help. A new ... a team at Harvard,s Wyss Institute for Biologically Inspired ... , "Even with the best current treatments, sepsis ... 30 percent of the time," said Mike Super, Ph.D., ...
Breaking Biology Technology:Global Market for Stem Cells to Reach $10.6 Billion in 2018; The Americas Growing at 13.9% CAGR 2Global Market for Stem Cells to Reach $10.6 Billion in 2018; The Americas Growing at 13.9% CAGR 3Elusive quantum transformations found near absolute zero 2Elusive quantum transformations found near absolute zero 3EnGeneIC Named a Recipient of the Cancer Institute NSW Premier's Award for Excellence in Translational Cancer Research 2EnGeneIC Named a Recipient of the Cancer Institute NSW Premier's Award for Excellence in Translational Cancer Research 3Blood-cleansing biospleen device developed for sepsis therapy 2Blood-cleansing biospleen device developed for sepsis therapy 3Blood-cleansing biospleen device developed for sepsis therapy 4
... ... , ... Ind. (Vocus) June 17, 2009 –- Pioneer Hi-Bred , a DuPont business, ... to bring additional corn and soybean products to growers in the marketplace. Under these ...
... 17 Campbell Alliance, the leading management consulting firm ... that it has appointed industry veterans Jon W. McGarity ... gentlemen will work directly with John Campbell, CEO of ... advise the firm,s emerging and midsize client companies. ...
... QC, June 17 /PRNewswire-FirstCall/ - BioSyntech, Inc. (TSX: ... regenerative medicine, today announced statistically significant results from ... month follow-up in the BST-CarGel(R) randomized clinical trial. ... quality due to BST-CarGel treatment was found during ...
Cached Biology Technology:Pioneer Hi-Bred and Beck's Hybrids Enter into Research and Distribution Agreements 2Pioneer Hi-Bred and Beck's Hybrids Enter into Research and Distribution Agreements 3Campbell Alliance Adds Industry Veterans Jon W. McGarity and David Lilley as Executive Vice Presidents 2Campbell Alliance Adds Industry Veterans Jon W. McGarity and David Lilley as Executive Vice Presidents 3Campbell Alliance Adds Industry Veterans Jon W. McGarity and David Lilley as Executive Vice Presidents 4BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 2BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 3BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 4BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 5
(Date:9/16/2014)... CRG researchers shed ... Journal of Cell Biology describes how Topo 2 disentangles ... At this very moment thousands of our body,s cells are ... body repairs damaged tissues and regenerates others like skin and ... during which the cell duplicates its genetic material and separates ...
(Date:9/16/2014)... , Sept. 16, 2014  Valencell, Inc., a leader ... as one of 18 "Showcase Companies" representing ... the annual CED Tech Venture Conference on September 16-17 ... Convention Center in Raleigh, North Carolina ... lead a discussion during the "Digital Health Spotlight Sector" ...
(Date:9/15/2014)... and gut microbes influence processes from digestion to disease ... most biodiverse terrestrial ecosystems on the planet, more is ... the tropics. Smithsonian scientists and colleagues working on Panama,s ... a single tree were home to more than 400 ... tree species contained more than 7,000 different kinds. , ...
Breaking Biology News(10 mins):Unraveling cell division 2Unraveling cell division 3Valencell, Inc. Selected as 'Showcase Company' at CED Tech Venture Conference 2014 2Smithsonian scientists discover tropical tree microbiome in Panama 2
... reefs build their structures by both producing and accumulating ... and continued vertical growth capacity of reefs. An international ... carbonate being added by Caribbean coral reefs is now ... in some habitats is as much as 70% lower. ...
... the climate began warming at the end of the last ... to a warmer climate. But how will forests adapt to ... Foundation has awarded a $1.5 million grant to Drs. Stephen ... from the University of Maryland Center for Environmental Science,s Appalachian ...
... technique have determined the precise configuration of humulones, substances ... That might not sound like a big deal ... reported in scientific literature in the last 40 years ... some types of cancer and other maladies. "Now ...
Cached Biology News:New evidence highlights threat to Caribbean coral reef growth 2New evidence highlights threat to Caribbean coral reef growth 3New study will predict how trees will adapt to rapid climate change 2Beer's bitter compounds could help brew new medicines 2
... Knockout System provides optimized reagents and protocols ... bacterial genes by insertion of group II ... of group II introns and utilizes a ... group II intron for specific insertion into ...
... monoclonal antibody raised against a partial recombinant MAK. ... a.a. ~ 457 a.a) partial recombinant protein with ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Biology Products: