Navigation Links
Nerium Recaps the 44th Annual NAACP Image Awards
Date:2/20/2013

Addison, Texas (PRWEB) February 20, 2013

Nerium International, a marketer of age-defying Nerium skin care products, was pleased to be invited to be the exclusive skincare of the National Association for the Advancement of Colored People (NAACP) Image Awards’ Gifting Suite.

The 44th Annual NAACP Image Awards aired live on Friday, Feb. 1, 2013 on NBC. The event honors the accomplishments of people of color in a variety of artistic fields, such as music, film, television and literature.

Every guest in the Image Awards Gifting Suite received Nerium skin care product. Notable guests included Samuel L. Jackson, whose performance in Django Unchained earned him the award for Best Supporting Actor in a Motion Picture. Performers Wyclef Jean and Common only brought the audience to its feet, and also enjoyed the free gift of NeriumAD.

Gladys Knight and Vanessa Williams were nominated for Best Supporting Actress in a Comedy Series, Gladys for her role as Grandma Carolyn in The First Family and Vanessa for her portrayal of Renee Perry on Desperate Housewives. While the competition was close, Vanessa went home with the award. Both actresses gladly accepted their NeriumAD before the night was over.

To learn more about the astounding age-defying qualifies of Nerium skin care products, please visit the Nerium blog.

About Nerium International:
Nerium™ International, LLC, headquartered in Addison, Texas, markets breakthrough products validated by science. In 2011, the relationship marketing company partnered with Nerium SkinCare™ Inc. (a subsidiary of Nerium Biotechnology, Inc.®), to deliver the NeriumAD™ skincare line. These first-of-their-kind products – clinically proven to reduce the appearance of fines lines and wrinkles – are the result of leading-edge research into the Nerium oleander plant and its age-def
'/>"/>

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

0

GOOD

Page: 1 2

Related biology technology :

1. Nerium Announcing Launch of New Blog Sites
2. Nerium Hosts Spring Bash 2013 in Various Locations
3. AbbVie to Present at Cowen and Company 33rd Annual Health Care Conference
4. Rosemary Gladstar Receives First-Annual ABC Mark Blumenthal Herbal Community Builder Award
5. Vermillion to Participate in Lazard Capital Markets 5th Annual Medical Technology Snowbird Conference on February 27, 2013
6. United Therapeutics Corporation To Announce Fourth Quarter And Annual 2012 Financial Results Before Market Open On Tuesday, February 26, 2013
7. The Elsevier Foundation, TWAS, and OWSD Honor Early Career Women Scientists in Developing Countries at the Annual AAAS Meeting
8. TPI to Hold 2012 Shareholder Annual Meeting on May 8, 2013 In New York City
9. Transonic sponsors Flow Measurement workshop at 9th Annual Scientific meeting of the Society of Diagnostic and Interventional Nephrology
10. Molecular Medicine Awards 1st Annual Ross Prize to NYU Researcher
11. Sigma-Aldrich Corporation Will Hold Its Annual Business Review March 21, 2013
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/19/2013)... , June 19, 2013 ... ) has announced the addition of the ... Opportunities, 2018" report to their offering. ... Lack of data protection and old ... PIN codes have driven the growth of ...
(Date:6/19/2013)... -- Continuing its long history of proven clinical performance in ... Inc. announces the U.S. Food and Drug Administration (FDA) ... assay for use on its Access 2 immunoassay system. ... Coulter,s troponin I test for over 12 years ... to continue providing dependability to laboratories supporting emergency care," ...
(Date:6/19/2013)... 2013 Biotechnology industry pioneer Amgen (NASDAQ: ... provider BlackLine Systems  and enterprise application software leader ... a webinar next week entitled "No Account Left Behind!  ... SAP to Help Keep Its Account Reconciliations in Good Shape ... The webinar, geared at finance, accounting, audit and ...
(Date:6/19/2013)... (PRWEB) June 19, 2013 Applied Rigaku ... report that details the measurement of sulfur in ultra-low ... QC+ high resolution benchtop EDXRF analyzer . The analysis ... test method ISO 13032. This International Standard specifies ... the determination of sulfur content in automotive gasoline. , ...
Breaking Biology Technology:Global Biometric Systems Market Forecast Report - Opportunities to 2018 2Global Biometric Systems Market Forecast Report - Opportunities to 2018 3Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 2Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 3Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 2Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 3Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 4Rigaku Publishes New Application Note for Analysis of ULSD Per ISO 13032 2
... Calif., May 8 Edwards Lifesciences,Corporation (NYSE: EW ... valves,announced that the company will celebrate a number of ... meeting of the American,Association for Thoracic Surgery (AATS), May ... by Edwards -- which this year celebrates,its 50th anniversary ...
... ALTO, Calif., May 8 Telik, Inc. (Nasdaq:,TELK) today ... per share, for,the first quarter ended March 31, 2008, ... per share, for the comparable period in 2007., ... costs and,expenses were $10.6 million, compared with $18.0 million ...
... Md., May 8 The Maryland Stem Cell,Research ... 122,applications in response to its three official Requests ... Maryland Technology Development,Corporation (TEDCO) reviewed the Commission,s recommendations ... Maryland Stem Cell Research,Fund (MSCRF) under the Maryland ...
Cached Biology Technology:Edwards Lifesciences Celebrates One Million Heart Valve Patients and More at AATS 2008 2Edwards Lifesciences Celebrates One Million Heart Valve Patients and More at AATS 2008 3Edwards Lifesciences Celebrates One Million Heart Valve Patients and More at AATS 2008 4Telik Announces First Quarter 2008 Financial Results 2Telik Announces First Quarter 2008 Financial Results 3Maryland Stem Cell Research Commission Recommends 62 Projects for Funding 2Maryland Stem Cell Research Commission Recommends 62 Projects for Funding 3
(Date:6/19/2013)... Course at the Marine Biological Laboratory (MBL), Woods ... Microbiology site by the American Society for Microbiology ... recognizes institutions and the scientists who worked there ... science of microbiology. A ceremony unveiling the ... for Saturday, June 22, 2013, at 4:30 pm ...
(Date:6/19/2013)... University of Pittsburgh has developed antibacterial compounds, derived ... be potential treatments for drug-resistant bacterial infections and ... are quite small, making them inexpensive and easy ... June 2013 issue of the journal Antimicrobial ... many probable applications will likely be the chronic ...
(Date:6/19/2013)... June 19, 2013 A decade-long JDRF-funded study ... Helmholtz Zentrum Mnchen, Germany, is providing a deeper ... risk of developing type 1 diabetes (T1D), highlighting ... for the disease. The study, "Seroconversion to Multiple ... in Children," was published today in The ...
Breaking Biology News(10 mins):Microbial diversity course designated as a 'Milestones in Microbiology' site 2HIV-derived antibacterial shows promise against drug-resistant bacteria 2New data on islet autoantibodies in young children defines early type 1 diabetes development 2
... that the loss of a gene called p63 accelerates aging ... many organisms, including humans. Therefore, the p63 gene is likely ... "To study how the p63 gene works, we devised a ... us right away was that these p63 deficient mice were ...
... study has followed a single humpback whale from one ... the migratory patterns of these majestic marine mammals in ... Society (WCS), the American Museum of Natural History (AMNH), ... Society's Biology Letters, a male humpback whale that was ...
... the introduction of the varicella (chicken pox) vaccine in ... have dropped dramatically, according to a study in the ... recommended for routine immunization of children aged 12 to ... in the United States, according to background information in ...
Cached Biology News:Gene loss accelerates aging 2Genetics links whale to two different ocean basins 2Hospitalizations because of chicken pox down dramatically since implementation of vaccine 2Hospitalizations because of chicken pox down dramatically since implementation of vaccine 3
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: