Navigation Links
Nebulized Formoterol Fumarate Has Comparable Pharmacokinetic and Pharmacodynamic Profile to Dry Powder Formulation
Date:5/20/2008

ulty coordinating the use of other devices as their disease progresses, nebulized Perforomist(TM) offers an effective, long-term treatment option."

The first study was a single-dose, double-blind, double-dummy crossover dose-ranging study conducted in 47 patients to establish the dose of Perforomist(TM) Inhalation Solution comparable to that of the marketed DPI, Foradil(R) Aerolizer(R). Mean FEV(1) AUC(0-12) (standardized area under the curve for FEV(1) over twelve hours) following FFIS treatment ranged from 1.3 to 3.0 L/hr in a dose-related manner, with identical values (2.3 L/hr) for Perforomist(TM) Inhalation Solution 20mcg and Foradil(R) Aerolizer(R). All other spirometry measures were comparable between FFIS and FA.

The second study involving thirteen COPD patients was a randomized, single-dose, open-label, crossover study comparing FFIS 10, 20, and 24mcg with Foradil(R) Aerolizer(R), which confirmed pharmacokinetic comparability between Perforomist(TM) Inhalation Solution 20mcg by nebulization and Foradil(R) Aerolizer(R) 12mcg (Foradil) by DPI.

"This research continues to support and highlight the clinical value of Perforomist(TM) Inhalation Solution," said Carolyn Myers, Ph.D., President of Dey, L.P. "We thank all of these eminent researchers for their contributions to the trials that were presented today and we remain dedicated to developing nebulized treatment options for those suffering from serious respiratory illnesses such as COPD."

For those attending ATS 2008, the presentations are available as follows:

Poster viewing: Session ID C42 COPD Pharmacotherapy I: Effects of

Bronchodilators

Tuesday, May 20, 2008, 10:45 a.m. - 12:30 p.m. EDT

Metro Toronto Convention Center; Area F: Halls A-B North Building, Level

300

-- Poster #F13: Dose-Ranging Study in COPD Patients Comparing

Pharmacodynamics of Formoterol Fumarate Delivered by Nebulization and

DPI

-- Poster #F
'/>"/>

SOURCE Dey L.P.
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6

Related biology technology :

1. Mylan Inc. Subsidiary, Dey, L.P., Announces that Perforomist(TM) (Formoterol Fumarate) Inhalation Solution is Now Available for Maintenance Treatment of COPD
2. New Patient Satisfaction Study With budesonide/formoterol Combination Therapy and fluticasone/salmeterol Combination Therapy in Adults With Asthma
3. ANX-514 Reduces Hypersensitivity Reactions Without Impacting Pharmacokinetics or Antitumor Activity in Preclinical Tests
4. ADVENTRX to Present Complete ANX-530 Pharmacokinetic Data at the 2008 American Association for Cancer Research Annual Meeting
5. PharmAthene Completes Pharmacokinetic Studies of Protexia(R); Program on Target for IND Filing in 2008
6. Halozyme Therapeutics Presents Favorable New Safety and Pharmacokinetic Data on rHuPH20 Enzyme Produced Via New Manufacturing Process at European Federation for Pharmaceutical Sciences
7. ANX-530 Demonstrates Equivalent Pharmacokinetics to Navelbine(R) in a Registrational Bioequivalence Clinical Study
8. Safety Profile of TAXUS(R) Liberte(TM) Stent System Highlighted in Worlds Largest Stent Registry
9. Clarient to Commercialize Novel Breast Cancer Profile
10. Finesse Solutions, LLC Announces OPC Connectivity With Nova BioProfile 400
11. Derma Sciences MEDIHONEY(TM) Profiled in Several Television News Health Reports
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:5/21/2015)...  The EveryLife Foundation for Rare Diseases applauded ... Amy Klobuchar (D-MN) today for introducing the ... or OPEN ACT. Supported by more ... bipartisan legislation promises to rapidly bring hundreds of ... patients by incentivizing drug makers to "repurpose" approved ...
(Date:5/21/2015)... (PRWEB) May 21, 2015 W. ... its manufacturing facility in Worms, Germany has received ... independent subsidiary of the International Pharmaceutical Excipient Council ... facilities that produce its SYLOID® FP brand of ... GMP certification, following the Curtis Bay, Maryland (USA) ...
(Date:5/21/2015)... , May 21, 2015  CytRx Corporation (NASDAQ: ... company specializing in oncology, today announced positive updated ... with aldoxorubicin for the treatment of unresectable glioblastoma ...  The open-label, multisite trial is designed to investigate ... patients whose tumors have progressed following prior treatment ...
(Date:5/21/2015)... Research and Markets ( http://www.researchandmarkets.com/research/84975r/2015_global ... "2015 Global Survey on Flow Cytometry Adoption Trends" ... primary goal of this research is to analyze ... Key information the survey seeks to collect include ... predominantly used applications for flow cytometers, respondents, most ...
Breaking Biology Technology:Advocates Cheer Senate Leaders for Introducing Bipartisan Bill to Increase Number of Rare Disease Treatments 2Grace European Facility Receives GMP Excipient Certification for SYLOID® FP Silica Gel 2CytRx Reports Positive Updated Phase 2 Aldoxorubicin Clinical Trial Results in Glioblastoma Multiforme (Brain Cancer) 2CytRx Reports Positive Updated Phase 2 Aldoxorubicin Clinical Trial Results in Glioblastoma Multiforme (Brain Cancer) 3CytRx Reports Positive Updated Phase 2 Aldoxorubicin Clinical Trial Results in Glioblastoma Multiforme (Brain Cancer) 4CytRx Reports Positive Updated Phase 2 Aldoxorubicin Clinical Trial Results in Glioblastoma Multiforme (Brain Cancer) 5CytRx Reports Positive Updated Phase 2 Aldoxorubicin Clinical Trial Results in Glioblastoma Multiforme (Brain Cancer) 6CytRx Reports Positive Updated Phase 2 Aldoxorubicin Clinical Trial Results in Glioblastoma Multiforme (Brain Cancer) 7Global Survey on Flow Cytometry Adoption Trends 2015 2
... Metavante Corp. , the banking and payments technology subsidiary ... the formation of a new cash-management division and the ... veteran Gary Kasik. , ,Kasik will run the division, ... manage investments, certain income statement items, payables, and receivables ...
... but I am an academic researcher at heart. I've also ... so I wear three sets of interchangeable glasses when assessing ... belly of the beast, I know too well the compromises ... door, but I am first and foremost a cognitive scientist ...
... - Adapting military research on hydrogen-powered refrigeration technology to ... more environmentally friendly, but only after they stop driving. ... rest, many leave their engines idling to regulate the ... diesel trucks on U.S. roads today, idling engines annually ...
Cached Biology Technology:Judging educational software 2Judging educational software 3Judging educational software 4Modine adapts military research to idling engines 2Modine adapts military research to idling engines 3
(Date:5/19/2015)... Research and Markets ( ... the  "Genetic Testing Market Outlook 2018"  report ... ,A recent report, Genetic Testing Market Outlook ... current and future genetic testing market. A ... principles and types are covered in this ...
(Date:5/11/2015)... SAN JOSE, Calif. , May 11, 2015 ... leading developer of human interface solutions, today announced ... Senior Vice President and Chief Financial Officer, reporting ... Mr. Ali replaces Synaptics, current Chief Financial Officer, ... in December 2014. Mr. Ali ...
(Date:5/8/2015)... , May 8, 2015 Synaptics Inc. (NASDAQ: ... today announced that members of the executive management team will ... 43rd Annual Technology, Media and Telecom Conference Date: May ... in Boston, MA Cowen ... 2015 Time: 2:45pm ET Location: The New York Palace Hotel, ...
Breaking Biology News(10 mins):Global Genetic Testing Market Outlook 2018 2Synaptics Appoints Wajid Ali as Senior Vice President and Chief Financial Officer 2Synaptics to Present at Upcoming Investor Conferences 2
... science and technology has seen exciting advances recently ... According to international scientific conventions, nanomaterials are those ... or equal to 10-9 m. At the same ... to enter ecosystems at the points of use ...
... 2012 Individuals with mutations in BRCA1 and BRCA2 genes ... cancers. Families at risk have been seeking genetic testing ... standard method of direct sequencing is labor-intensive, costly, and it ... A group of Canadian scientists has developed a new ...
... study of North American songbirds reveals that birds that live ... up helps birds ensure that their songs are heard no ... and the National Evolutionary Synthesis Center. To test the ... male birds spanning 44 species of North American songbirds ...
Cached Biology News:Understanding the biological and ecological implications of safe nanotechnology 2New method provides fast, accurate, low cost analysis of BRCA gene mutations in breast cancer 2Birds that live with varying weather sing more versatile songs 2
...
... is an evolutionarily conserved form of cell ... The central component of this process ... caspases. These enzymes participate in a ... response to pro-apoptotic signals and result in ...
... for high-yield protein expression ,The ... a high-yielding clone of Sf9 cells. Pre-adapted ... Cell Medium, these cells are recommended for ... baculovirus infection or transfection of appropriate vectors. ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Biology Products: