Navigation Links
Nanowrinkles, nanofolds yield strange hidden channels
Date:11/22/2011

PROVIDENCE, R.I. -- Wrinkles and folds are ubiquitous. They occur in furrowed brows, planetary topology, the surface of the human brain, even the bottom of a gecko's foot. In many cases, they are nature's ingenious way of packing more surface area into a limited space. Scientists, mimicking nature, have long sought to manipulate surfaces to create wrinkles and folds to make smaller, more flexible electronic devices, fluid-carrying nanochannels or even printable cell phones and computers.

But to attain those technology-bending feats, scientists must fully understand the profile and performance of wrinkles and folds at the nanoscale, dimensions 1/50,000th the thickness of a human hair. In a series of observations and experiments, engineers at Brown University and in Korea have discovered unusual properties in wrinkles and folds at the nanoscale. The researchers report that wrinkles created on super-thin films have hidden long waves that lengthen even when the film is compressed. The team also discovered that when folds are formed in such films, closed nanochannels appear below the surface, like thousands of super-tiny pipes.

"Wrinkles are everywhere in science," said Kyung-Suk Kim, professor of engineering at Brown and corresponding author of the paper published in the journal Proceedings of the Royal Society A. "But they hold certain secrets. With this study, we have found mathematically how the wrinkle spacings of a thin sheet are determined on a largely deformed soft substrate and how the wrinkles evolve into regular folds."

Wrinkles are made when a thin stiff sheet is buckled on a soft foundation or in a soft surrounding. They are precursors of regular folds: When the sheet is compressed enough, the wrinkles are so closely spaced that they form folds. The folds are interesting to manufacturers, because they can fit a large surface area of a sheet in a finite space.

Kim and his team laid gold nanogranular film sheets ran
'/>"/>

Contact: Richard Lewis
Richard_Lewis@brown.edu
401-863-3766
Brown University
Source:Eurekalert  

Page: 1 2

Related biology technology :

1. New England Biolabs Develops Novel Small RNA NGS Protocol: Reagents Improve Yield and Decrease Adaptor-Dimer Formation
2. Growing nanowires horizontally yields new benefit: nano-LEDs
3. Mendel Announces US Miscanthus Field Trial Results: Second Year Data Demonstrate High-Yielding, Genetically Diverse Product Portfolio
4. Preemergence Herbicides from FMC Boost Early Season Plant Health in Corn and Soybeans and Help Optimize Yields for 2010
5. New Study Shows Nu-Tek's Modified Potassium Chloride Improves Yields in Meat Processing
6. DuPont Congratulates Wright for Highest Overall Yield with Pioneer Brand Hybrid 32N73 in 2009 NCGA Corn Yield Contest
7. Medication Adherence Technology Combines with Patient Outreach Program to Yield Healthier Populations and Reduce Healthcare Costs
8. Blue Dye Test Alternative Boosts Production Yields During Tough Times
9. SoluLinK Introduces Product that Links All Biomolecules Greater Than 20 Times Faster with 100% Yields
10. Strain on nanocrystals could yield colossal results
11. Syngenta Acquires Innovative Bio-Control Technology to Improve Usable Crop Yields
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Nanowrinkles, nanofolds yield strange hidden channels
(Date:9/16/2014)... Valley, Arizona (PRWEB) September 16, 2014 ... that develops safe and effective products to treat ... the use of a proprietary SPACEā„¢ Technology Platform ... Officer and President will present at the White ... 2014 at the Hyatt Regency Phoenix. In ...
(Date:9/16/2014)... , Sept. 16, 2014  Ascendis Pharma ... TransCon technology to address significant unmet medical needs, ... Phase 2 pediatric study to evaluate once-weekly TransCon ... or GHD.  The full interim results will be ... GRS and IGF Society, being held October 15-18, ...
(Date:9/16/2014)... According to Jeff Howell, Partner of Nidea ... new development in Downtown Toronto is expanding at a ... 755 storeys of new development last week (including three ... dominating the Toronto skyline for the foreseeable future in ... for new development. , As the Toronto city council ...
(Date:9/15/2014)... GREENBELT, Md. , Sept. 15, 2014 /PRNewswire/ ... a leading innovator of scientific products and services ... government-wide One Acquisition Solution for Integrated Services (OASIS) ... Service (FAS). GST was selected to provide the ... in the Small Business (SB) category in Pool ...
Breaking Biology Technology:Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 2Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 2Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 4ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 2ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 3Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 2Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 3
... HUBBARD, Ohio, Sept. 24 /PRNewswire-Firstcall/ -- NanoLogix, Inc. ... an exhibitor and,participant in the "Energy from Biomass ... David L. Lawrence Convention,Center in Pittsburgh, Pennsylvania September ... NanoLogix booth at the Expo, with,Dana Allen, Bret ...
... Seasoned leader brings added expertise to Shire ... England, Sept. 24, Shire plc (LSE: SHP, ... company, announced today that Sylvie,Gregoire has been ... (HGT),business, effective immediately. Sylvie brings more than ...
... BioCryst,Pharmaceuticals, Inc. (Nasdaq: BCRX ) today ... Life Sciences Conference in New York. A live ... 2007 at 2:00 p.m. Eastern,Time may be accessed ... will be archived for seven days. (Logo: ...
Cached Biology Technology:NanoLogix Inc. to Present at EBW Expo & Conference 2007 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 3Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 4BioCryst to Present at UBS 2007 Global Life Sciences Conference 2BioCryst to Present at UBS 2007 Global Life Sciences Conference 3
(Date:9/16/2014)... to make ethical choices such as buying clothing not ... fair-trade coffee, and bringing their own bags when they ... Journal of Consumer Research , ethical consumption is ... emotions about unethical practices into action. , "Advocates of ... and human costs of the products they choose, but ...
(Date:9/16/2014)... practically all vital functions in an organism. For ... particular substances and control immune system responses. Researchers ... function independently of each other, but instead form ... networks, you find many similarities with online social ... of Plant Systems Biology. "Some proteins are good ...
(Date:9/16/2014)... , Sept. 16, 2014  Cross Match Technologies, ... solutions, announced today the launch of its Verifier ... the identity of an individual using their secure ... Sentry rapidly reads credential documents with embedded biometric ... matching the biometric to a live scan of ...
Breaking Biology News(10 mins):Why are consumers willing to spend more money on ethical products? 2Good networkers make prime targets 2Cross Match Launches New Identity Management Handheld Solution 2
... Children's Hospital of Philadelphia leads a multi-center $6.7 million ... of Mental Health (NIMH) to explore a novel approach ... studies and clinical trials in adult patients, the new ... human immunodeficiency virus: sites on immune cells known as ...
... found Envisat's MERIS sensor can detect coral bleaching ... could potentially monitor impacted coral reefs worldwide on ... symbiotic algae living in symbiosis with living coral ... expelled. The whitening coral may die with subsequent ...
... what happens in cells is the work of machines that ... human and other genomes, researchers now have a nearly complete ... manual telling where all the pieces go. A new study ... to answer this question for some of the smallest and ...
Cached Biology News:Federal grant funds research on novel HIV therapy 2Federal grant funds research on novel HIV therapy 3Health of coral reefs detected from orbit 2Many needles, many haystacks 2
... Knockout System provides optimized reagents and protocols ... bacterial genes by insertion of group II ... of group II introns and utilizes a ... group II intron for specific insertion into ...
... monoclonal antibody raised against a partial recombinant MAK. ... a.a. ~ 457 a.a) partial recombinant protein with ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Biology Products: