Navigation Links
NSG's Releases New Toluene in Hexane Reference Standard for Resolution and Spectral Bandwidth Verification
Date:6/25/2013

Farmingdale, NY (PRWEB) June 25, 2013

The Spectral Bandwidth (SBW) of a spectrophotometer is the basis of establishing its ability to resolve absorption lines separated by small differences in wavelength. If a substance that requires measurement has an absorption line at 257.4nm and there is an interfering line at 260.0 nm, one needs to establish whether the spectrophotometer can resolve the two lines separately or if it "mixes" the two absorption lines into a single line. This brings about erroneous results. Toluene in Hexane is used as a reference for the calculation of SBW. The ratio of the absorption of the solution when read at a maxima (around 268.7nm) and at a minima (around 267.0nm) relates directly to the SBW of the instrument being assessed. Regular use of this technique will assure that the resolution of your instrument is within the required range for Good Laboratory Practice.

Assessing the photometric and wavelength performance of a UV/VIS spectrophotometer is a necessary part of keeping a laboratory in accordance with GLP standards which makes NSG Precision Cells' Toluene in Hexane a necessity. Understanding and accounting for how expanded uncertainties affect these measurements is a critical component of the calibration process.

NSG's Toluene in Hexane reference standard ensures accurate wavelength and absorbance results by verifying the spectrophotometer's resolution. Accurate absorbance and wavelength measurements can only be achieved if due consideration is given to the resolution of the monochromator in use. In modern instruments with grating monochromato
'/>"/>

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

Page: 1 2 3

Related biology technology :

1. HealthCare Institute of New Jersey Releases 2011 Biopharmaceutical and Medical Technology Economic Impact Data
2. HCCS Releases ICD-10 Countdown Clock With Integrated CMS Twitter Tweets
3. eCareSoft Releases eCS Cirrus™
4. AtheroNova Releases 2011 Financial Results
5. Atlanta LASIK Surgeon Dr. Ashraf Releases YouTube Videos Featuring Patient Testimonials and Discussion of Common Eye Treatments
6. ILVO-T&V Belgium Releases Validation Report of the Charm Sciences Beta-lactam and Tetracycline 2-minute Test for Raw Commingled Milk
7. ISPE Releases New Guidance for Designing and Constructing Packaging, Labeling and Warehousing Facilities
8. Happtique Releases Draft App Certification Program Standards For Public Comment
9. ClearCanvas Releases New Workstation Products Designed to Assist With Image Sharing
10. OneMedPlace Releases Update to Research Report on Amarantus Biosciences Focused on New Positive Ischemic Heart Disease Efficacy Data for MANF in Animals
11. Weight Loss: Natural Way To Lose More Weight Than With Diet & Exercise Alone - Consumer Reporter Releases A New Video
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/19/2014)... Calif. , Dec. 19, 2014  Roche (SIX: ... of Bina Technologies, Inc. (Bina), a privately held ... , USA. Bina provides a big data ... generation sequencing (NGS) data. Bina,s proprietary on-market Genomic ... and academic researchers to perform fast and scalable ...
(Date:12/19/2014)... December 18, 2014 BioPlus ... leading specialty pharmacies, has an expanded team of ... pharmacy consultants for prescriber offices in their regions, ... , “We have a variety of Regional Pharmaceutical ... those specializing in hepatitis C help prescribers understand ...
(Date:12/19/2014)... 18, 2014 Reports from CDC ... States suffer from one or more chronic health conditions ... Medication can address some of these diseases, but may ... many sufferers face. While implanted nerve stimulation devices today ... whole nerve, which can induce side effects. , ...
(Date:12/19/2014)... Diego, CA (PRWEB) December 18, 2014 ... a limited time special on Sartorius Biohit products ... Free on mLINE pipettes, Picus Electronic Pipette Trade-in Program, ... by Health and Safety officers around the world. They ... manual pipetting. Other features include:, ,     Full ...
Breaking Biology Technology:Roche acquires Bina Technologies and enters the genomic informatics market 2Roche acquires Bina Technologies and enters the genomic informatics market 3BioPlus Specialty Pharmacy Expands ‘Regional Pharmaceutical Care Liaison’ Team 2BioPlus Specialty Pharmacy Expands ‘Regional Pharmaceutical Care Liaison’ Team 3Draper Wins GSK Funding for Smaller, Smarter Implantable Devices 2Major Pipette Distributor Pipette.com Announces Sartorius Year End Specials 2
... BioMed Realty Trust, Inc. (NYSE: BMR ), a real ... Science Industry®, today announced financial results for the third quarter ended ... Generated record total revenues for the third quarter of ... in 2009. Increased rental revenues for the third quarter by ...
... to develop relatively advanced tools after their brains evolved a ... that investigates why it took early humans almost two million ... axe. Researchers used computer modelling and tiny sensors embedded ... humans needed in order to make two types of tools ...
... New Mexico, NOVEMBER 3, 2010Scientists at the U.S. Department ... Laboratory have fabricated transparent thin films capable of absorbing ... area. The material, described in the journal Chemistry ... transparent solar panels. "Potentially, with future refinement of ...
Cached Biology Technology:BioMed Realty Trust Reports Third Quarter 2010 Financial Results 2BioMed Realty Trust Reports Third Quarter 2010 Financial Results 3BioMed Realty Trust Reports Third Quarter 2010 Financial Results 4BioMed Realty Trust Reports Third Quarter 2010 Financial Results 5BioMed Realty Trust Reports Third Quarter 2010 Financial Results 6BioMed Realty Trust Reports Third Quarter 2010 Financial Results 7BioMed Realty Trust Reports Third Quarter 2010 Financial Results 8BioMed Realty Trust Reports Third Quarter 2010 Financial Results 9BioMed Realty Trust Reports Third Quarter 2010 Financial Results 10BioMed Realty Trust Reports Third Quarter 2010 Financial Results 11BioMed Realty Trust Reports Third Quarter 2010 Financial Results 12BioMed Realty Trust Reports Third Quarter 2010 Financial Results 13BioMed Realty Trust Reports Third Quarter 2010 Financial Results 14BioMed Realty Trust Reports Third Quarter 2010 Financial Results 15BioMed Realty Trust Reports Third Quarter 2010 Financial Results 16BioMed Realty Trust Reports Third Quarter 2010 Financial Results 17Stone Age humans needed more brain power to make big leap in tool design 2Scientists produce transparent, light-harvesting material 2
(Date:12/11/2014)... 2014  Data Sciences International (DSI), the global ... new series of digital telemetry implants to meet ... series, part of the PhysioTel™ Digital platform, was ... physiologic data when incorporating functional endpoints into repeat-dose ... toxicology studies has evolved from short ECG strips ...
(Date:12/10/2014)... DIEGO , Dec. 9, 2014 CIE ... collaboration catalyst that provides the connective tissue that enhances ... enabling them to easily share client-level information; earned a ... to expand to organizations serving seniors aging in community ... Diego" partner on December 11 th 4-6p. ...
(Date:12/5/2014)... , Dec. 4, 2014  Tute Genomics, a leader ... million in Series A1 funding led by UK-based Eurovestech. ... participated in the investment round. "We are ... community adopts next-generation sequencing and seeks new approaches for ... Reid Robison , MD MBA, and CEO of Tute ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... You don,t need to spray weedkiller to remove the ... with either boiling water, steam or flaming will dispatch even ... a new PhD project from the University of Copenhagen. ... is important that each treatment is dosed correctly. Basically, ...
... Johns Hopkins scientists have engineered cells that behave like ... on one or more unique inputs. This feat, published in ... eventually help researchers create computers that use cells as tiny ... in the Department of Cell Biology and member of the ...
... BETHESDA, MD May 30, 2012 The Genetics Society ... six graduate students and seven postdoctoral researchers as recipients of ... Each of these early-career geneticists receives a $1,000 travel award ... in a laboratory course of their choice that will enhance ...
Cached Biology News:Blanch your weeds 2Training cells to perform Boolean functions? It's logical 2Training cells to perform Boolean functions? It's logical 3The Genetics Society of America announces DeLill Nasser Travel Award recipients 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: