Navigation Links
NBA All-Star Alonzo Mourning is at the Top of his Game When It Comes to Spreading the Word About Chronic Kidney Disease
Date:3/5/2008

The American Association of Kidney Patients Honors Mourning with 2008 Life

Membership Award During National Kidney Month

MIAMI, March 5 /PRNewswire/ -- To recognize his extraordinary commitment to raising awareness of chronic kidney disease (CKD), the American Association of Kidney Patients (AAKP) today announced that Alonzo Mourning, seven-time National Basketball Association (NBA) All-Star and center for the Miami HEAT, is the 2008 recipient of AAKP's Life Membership Award. AAKP will honor Mourning at tonight's Miami HEAT game vs. the Toronto Raptors during the half-time show.

Mourning was diagnosed with kidney disease in 2000, and had a kidney transplant in 2003. Since then, Mourning has made a triumphant return to the NBA, and has dedicated much of his life to helping others with kidney disease.

"It is a great honor to receive this award from AAKP, an organization that does important work for people living with CKD," said Mourning. "My biggest win is that I am healthy and, with groups like AAKP, I am able to help fight CKD by encouraging people who are at risk to talk to their doctors and get tested and treated as early as possible."

Earlier today, a kick-off breakfast was held at the AmericanAirlines Arena for National Kidney Month and to recognize Mourning for his dedication to raising awareness of CKD. The breakfast was sponsored by Ortho Biotech Products, L.P.

"Since his diagnosis, Mourning has been motivating physicians and the public to take action -- encouraging those who are at risk for chronic kidney disease to get tested and treated," said AAKP President Roberta Wager, RN, MSN. "Because of his tireless commitment and drive to raise public awareness and money for research -- and his ability to share his personal experience living with this disease -- Mourning has touched countless lives with his important message."

About Chronic Kidney Disease

Chronic kidney disease is a progressive c
'/>"/>

SOURCE American Association of Kidney Patients
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. BioStorage Technologies Becomes Green Powered through the Use of 100% Certified Renewable Energy
2. Haemonetics Becomes Preferred Provider of Plasma Collection Products to Octapharma Europe
3. Free CME-certified Webcast: Opening the Door to Better Myocardial Infarction Outcomes: Emergency Departments Hold the Key
4. UPDATE: Free CME-certified Webcast: Opening the Door to Better Myocardial Infarction Outcomes: Emergency Departments Hold the Key
5. Prof. Michel Klein Becomes Chief Scientific Officer at AMVAC
6. Use of Fractional Flow for Optimizing Patient Outcomes is Topic of Several Sessions at TCT 2007
7. REMICADE(R) Becomes First Anti-TNF Biologic Therapy to Treat One Million Patients Worldwide
8. GlaxoSmithKline Responds to JAMA Article on the ICES Thiazolidinediones and Cardiovascular Outcomes in Older Patients with Diabetes
9. Medicsight Welcomes U.S. Initiative to Reimburse CT Colonography for Early Detection of Colorectal Cancer
10. Start Licensing, Inc. Welcomes FDAs Finding of Safety of Food From Cloned Animals
11. BioSpace Career Fair in San Francisco Welcomes Over 1,000 Bioscience Professionals
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/22/2014)... 21, 2014   ... Commercial Officer zu KLOX    ... Chief Financial Officer bestellt    KLOX ... seines jüngst zugelassenen Behandlungssystems zur Wundheilung zu beginnen    ... "Unternehmen") ist sehr erfreut, die folgenden personellen Veränderungen anzukündigen: ...
(Date:11/21/2014)... BELLINGHAM, Washington, USA (PRWEB) November 19, 2014 ... used in our lives was shared with more than ... undergraduate and postgraduate students from the University of Otago ... Outreach Grant . The Otago students, members of the ... Southland New Zealand in early September, giving children from ...
(Date:11/21/2014)... 20, 2014 The California ... research organization representing leading California academic institutions, biotechnology, ... PwC US today released a report revealing ... industry growth. The trend shows a 4 percent ... California Biomedical Industry Report indicates that, while ...
(Date:11/21/2014)... Fayetteville, Arkansas (PRWEB) November 20, 2014 ... partners, Pinnacle Ozone Solutions, LLC (Pinnacle), and PCI, ... equipment, announced that they have been selected to ... City of Fayetteville, Arkansas Paul R. Noland Wastewater ... feature BlueInGreen’s patented HyDOZ® gas dissolution ...
Breaking Biology Technology:KLOX Technologies meldet Neubesetzung von Führungspositionen 2KLOX Technologies meldet Neubesetzung von Führungspositionen 3KLOX Technologies meldet Neubesetzung von Führungspositionen 4KLOX Technologies meldet Neubesetzung von Führungspositionen 5Optics and photonics outreach programs share science, spark fascination with light 2Optics and photonics outreach programs share science, spark fascination with light 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 2California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 4City of Fayetteville Leads Nation with Innovative Ozone Technology 2City of Fayetteville Leads Nation with Innovative Ozone Technology 3City of Fayetteville Leads Nation with Innovative Ozone Technology 4
... veteran, was promoted to president of the General Electric Medical ... who left to become CEO at Invitrogen. The division focuses ... systems . , ,It's a dream job for a corporate ... about $9 billion and produced GE CEO and Chairman Jeffery ...
... develops and sells employee scheduling and management products. The ... and co-founder of Suite Scheduler, a former nurse manager ... employees in a facility. , ,Suite Scheduler products are ... up to 90% of the time to create and ...
... That is, until he gets to the better drugs, faster ... the science behind the Madison-based companys products is likely to ... nears the age when diseases and treatments become as common ... the two and a half-year-old company that Vodenlich joined as ...
Cached Biology Technology:CEO Wilson Defines GE's Health-IT Customer 2CEO Wilson Defines GE's Health-IT Customer 3CEO Wilson Defines GE's Health-IT Customer 4Scheduling made easy with Suite Scheduler 2Scheduling made easy with Suite Scheduler 3Chipping Away at Drug Development 2Chipping Away at Drug Development 3
(Date:11/18/2014)... , Nov. 18, 2014   EyeLock Inc. ... solutions, and MorphoTrust USA (Safran), a ... today announced a strategic partnership to offer comprehensive ... vehicle administration (MVA), airport screening and financial services ... solutions, MorphoTrust serves consumers through a nationwide network ...
(Date:11/11/2014)... , Nov. 11, 2014  Forensicon, Inc., a ... firm, is pleased to announce the promotion of ... Director of Digital Forensics. In Schiff,s new role as ... the team of digital forensics examiners and provide leadership ... Photo - http://photos.prnewswire.com/prnh/20141110/157719 ...
(Date:11/7/2014)... Calif. , Nov. 7, 2014  In conjunction with ... Police Departments, The Community Foundation of the Verdugos ... DNA JUSTICE PROJECT," a $250,000 initiative to keep ... initial phase. In its first six months of existence, the ... needed evidence support for local law enforcement. "Because ...
Breaking Biology News(10 mins):EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 2EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 3Yaniv Schiff Promoted to Director of Digital Forensics at Forensicon, Inc. 2Community Foundation Of The Verdugos Unveils Campaign To Fund Glendale-Burbank DNA Justice Project 2
... February 26, 2013, New York, N.Y. and San Diego, Calif. ... tumor in adults, is challenging to treat because the tumors ... more about the causes of tumor cell growth and drug ... new targeted therapies to potentially treat this deadly cancer. ...
... 2013, Reston, VAResearchers will meet at the Society of ... a number of health concerns that have received growing ... of the presentations, scientists will explore how the development ... related exposures might affect the risk assessment of arsenic ...
... Rockville, Md. The Association for Research in Vision ... three keynote speakers, including two Nobel laureates, during the ... Wash. New this year, the ARVO/Alcon Keynote Series ... Christopher Murray, MD, DPhil. Smithies, of the University ...
Cached Biology News:Novel combination therapy shuts down escape route, killing glioblastoma tumor cells 2Scientists explore topical health issues at meeting in Texas 23 distinguished keynote speakers to present during ARVO 2013 Annual Meeting 2
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... sufficient materials for 1,464 array sample elements. , , ... , Blocker BSA in PBS (10X): 50 ml ... BupH Phosphate Buffered Saline: 8 packs , 10% ... Pico Luminol Enhancer: 2 x 25 ml , SuperSignal ...
Biology Products: