Navigation Links
My Cleaning Products Reveals Nelson Castro Once Sponsored a Bed Bug Bill, Offers Samples of Non-Pesticide Bed Bug Spray
Date:4/11/2013

New York, NY (PRWEB) April 11, 2013

A number of bed bug bills have been proposed the previous years. And based on a previous post from state.ny.us dated June 11, 2012, Nelson Castro passed one before. My Cleaning Products commented that bills such as his are particularly needed nowadays given the prevalence of the pests. And wanting to also help the public, it published a bed bug guide of its own enumerating the things needed to fight off the pests. It also offered samples of its bed bug spray called Bed Bug Bully.

As said in the post, Castro's bed bug bill required bedding material transported or sold in the state be sanitized to prevent the pests, My Cleaning Products stated. However, the former Bronx Democratic Assemblyman's bill failed to get the nod of the Senate, it added.

Given the current widespread of bed bugs, the company asserted that proposed laws as that of Castro's are needed by the public. And wanting to also help them, it posted a new bed bug guide on its website. The guide basically listed down things a person needs to kill bed bugs and prevent their comeback.

Here is a part of My Cleaning Products' new bed bug guide.

“Bed bugs are now everywhere. There are reports about them infesting houses, apartments, hotels, nursing homes, commercial establishments and even buses and trains.

"Sure, as you might already know, they don't transfer
'/>"/>

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Father's Day Special: MyCleaningProducts Discounts Rust Removers and Other Cleaners for 27%
2. Scientists gain understanding of self-cleaning gecko foot hair
3. Green Cleaning Moms Receive Aid from MyCleaningProducts; MCP Now Supplies Non-Toxic Rust Remover and Other Cleaners
4. Cleaners Double as Wellness Promoters; MyCleaningProducts Lines Health and Eco Friendly Cleaning Products
5. MyCleaningProducts Invites Moms to Join the Green Crusade With Its Eco-Friendly Rust Removers and Other Cleaners
6. Mandy Moore Campaigns for Clean Water, GreenBeanBuddy Encourages Mothers to Help Through the Use of Green Cleaning Products
7. Sandy Mold Extends Its Health Risks to Hired Cleaners; My Cleaning Products Says Complete Mold Treatment Gear and Molderizer are Needed to Stop Mold and Its Risks
8. My Cleaning Products Marks Down Its Bed Bug Bully Price by 20%
9. My Cleaning Products Announces its Christmas Special, Sells Rusterizer at 20% Less
10. Christmas Special: My Cleaning Products Celebrates Holiday With a Molderizer and Safe Shield Markdown for its Clients
11. Shoppers Get Roach Bully Discount From My Cleaning Products
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/19/2014)... San Diego, CA (PRWEB) December 18, 2014 ... announces a limited time special on Sartorius Biohit ... 1 Free on mLINE pipettes, Picus Electronic Pipette Trade-in ... recommended by Health and Safety officers around the world. ... repetitive manual pipetting. Other features include:, , ...
(Date:12/19/2014)... 18, 2014   ISN has released its ... Indicators publication series. With data aggregated from ... in 2013 within its online contractor management platform, ISNetworld, ... performance indicator (KPI) statistics. The ... publication is available in two industry specific volumes: ...
(Date:12/17/2014)... Based on the revenues gained ... market is dominated by four major players contributing ... These players include GE Healthcare (U.K.), Siemens AG ... , Full Report Copy at http://www.marketsandmarkets.com/Market-Reports/surgical-imaging-market-210534462.html ... be attributed to its strong product portfolio, which ...
(Date:12/17/2014)... BASKING RIDGE, N.J. (PRWEB) December 17, 2014 ... Ipsen (Euronext: IPN; ADR: IPSEY), ... 120 mg (referred to as Somatuline®) was approved ... for the treatment of gastroenteropancreatic neuroendocrine tumors (GEP-NETs) ... differentiated, locally advanced or metastatic disease to improve ...
Breaking Biology Technology:Major Pipette Distributor Pipette.com Announces Sartorius Year End Specials 2ISN Releases Third Edition of US Contractor Health & Safety Performance Indicators Publication Series 2ISN Releases Third Edition of US Contractor Health & Safety Performance Indicators Publication Series 3Global Refurbished Surgical Imaging Market by Product & Application is Estimated to Reach $1.25 Billion by 2019 - New Research Report by MarketsandMarkets 2Global Refurbished Surgical Imaging Market by Product & Application is Estimated to Reach $1.25 Billion by 2019 - New Research Report by MarketsandMarkets 3Global Refurbished Surgical Imaging Market by Product & Application is Estimated to Reach $1.25 Billion by 2019 - New Research Report by MarketsandMarkets 4Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 2Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 3Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 4Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 5Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 6Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 7Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 8
... 2011 Verenium Corporation (Nasdaq: VRNM ), ... industrial enzyme solutions, today announced that James Levine, Executive ... the upcoming Piper Jaffray Sixth Annual Clean Technology & ... 3:00 p.m. EST on Wednesday, January 12, 2011 and ...
... , WEST LAFAYETTE, Ind. - Researchers are creating a ... natural photosynthetic systems in plants by using carbon nanotubes ... and reducing cost. "We,ve created artificial photosystems using ... to electrical power," said Jong Hyun Choi, an assistant ...
... and BUDAPEST, Hungary, Jan. 4, 2011 The IP ... property research and analysis solutions, and ChemAxon, the leader ... announced a strategic partnership whereby Thomson Reuters is providing ... patent data to users of ChemAxon,s JChem chemical software ...
Cached Biology Technology:Verenium to Present at Piper Jaffray Sixth Annual Clean Technology & Renewables Conference 2Verenium to Present at Piper Jaffray Sixth Annual Clean Technology & Renewables Conference 3New solar cell self-repairs like natural plant systems 2Thomson Reuters and ChemAxon Partner to Help Speed Drug Discovery for Life Science Researchers 2Thomson Reuters and ChemAxon Partner to Help Speed Drug Discovery for Life Science Researchers 3
(Date:12/11/2014)... , Dec. 09, 2014 Research and Markets ... ( http://www.researchandmarkets.com/research/9ql3kr/biometrics_market ) has announced ... India 2015-2019" report to their offering. ... market is the adoption of multimodal biometric systems. ... of an individual for verification and identification purposes. ...
(Date:12/10/2014)... 2014  Wake Forest Baptist Medical Center today announced plans ... of Medicine. Funding for this $50 million capital project ... be publicly launched next summer. The ... 60 series R.J. Reynolds Tobacco Company complex, adjacent to ... immediately with plans to be ready to welcome medical ...
(Date:12/5/2014)... -- Tute Genomics, a leader in cloud-based solutions for genome ... led by UK-based Eurovestech. Peak Ventures and a number ... "We are at a pivotal time in ... seeks new approaches for the diagnosis, treatment and prevention ... and CEO of Tute Genomics. "One of the main ...
Breaking Biology News(10 mins):Biometrics Market in India 2015-2019: Key Vendors are 3M Cogent, NEC, Safran and Suprema 2Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 2Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 3Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... a soil science professor at the University of Guam, has ... use in shielding the reefs in Pago Bay from the ... major health hazards facing Guam,s reefs is soil erosion resulting ... up a reef system. "Vetiver,s ability to tolerate high stress ...
... fog, tennis shoes, chocolate mousse, and proteins have something in ... of research that explains the behavior of a wide variety ... and a number of biological materials. In the ... made of (Springer), Roberto Piazza, professor of condensed matter physics, ...
... in their personal and professional lives, University of ... gain greater control over their thoughts with real-time ... first investigation of how real-time functional Magnetic Resonance ... for higher-order thoughts, including introspection, affects our ability ...
Cached Biology News:Bioengineering with vetiver grass on Guam 2Soft matter -- the stuff that dreams are made of 2People control thoughts better when they see their brain activity: UBC study 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: