Navigation Links
Medtech companies urged to evolve business model to survive
Date:9/23/2013

f pre-commercial companies — declined by 11% to the lowest level in at least seven years.
  • Financing: Capital raised remained relatively steady at US$29.5b, but most of the funding went to a few large companies. Debt represents the vast majority of total funding, with debt offerings by a handful of commercial leaders contributing 82% of the industry's total financing. The majority of new debt issuances were used to refinance existing debt.
  • Deal making holds steady. The value of mergers and acquisitions involving US and European medtech companies increased 23% to US$47b. However, after adjusting for a US$15.8b mega-deal, the value of M&A in 2012 fell 19% to US$31.2b.
  • Building new business models

    Continues Glen: "The move to value-based health care is making patients and payers more influential, and medtech companies now find that their business models need to take these new customers into account. However, the need to invest heavily in business model innovation comes at precisely the time when companies' resources are increasingly constrained."

    Companies are beginning to experiment with business models that reflect the needs of new customers in three ways: 

    • Beyond the product: Services and solutions to improve outcomes or lower costs (e.g., a 15-year agreement to provide a US academic medical center with consulting services as well as technology).
    • Beyond treatment: Prevention, remote monitoring, to more efficiently improve outcomes (e.g., a major device company's US$200 million acquisition last month of a telehealth firm focused on remote chronic disease management.) 
    • Beyond the hospital: Enabling patients to manage their conditions at home, without frequent and costly clinical interventions (e.g., a leading medtech company's new program to treat sleep disorders through education and encouragement.)

    Building
    '/>"/>

    SOURCE EY
    Copyright©2012 PR Newswire.
    All rights reserved

    Page: 1 2 3 4

    Related biology technology :

    1. Day Two of AdvaMed 2013 to Feature Government and Industry Leaders on MedTech Challenges and Opportunities
    2. International MedTech Industry a Major Focus at AdvaMed 2013
    3. Medtech College Recognizes Medical Billers & Coders For "Cracking The Code" Of Insurance, Patient And Physician Billing
    4. MedTech Innovate Seminars: New Interactive Learning Forums at 2013 MD&M East
    5. BioBDx to Present at the 2012 BioPharm America and AdvaMed MedTech Conferences in Boston
    6. Medtech Expands Nursing Education Opportunities In Florida
    7. MD+DI, the Global MedTech Industry Authority, Wins a 2012 Maggie for Best Overall Category in Medical, Dental & Related Services/Trade
    8. MD+DI, the Global MedTech Industry Authority, Wins a 2012 Maggie for Best Cover in the Medical, Dental & Related Services/Trade Category
    9. UBM Canon, the Global MedTech Authority, and the Medical Design Excellence Awards Announce Dean Kamen as the Presenter of the 2012 Lifetime Achievement Award
    10. Camelot Healthcare Training Institute Acquired by Medtech
    11. Workforce Solutions Company Kaztronix is Recognized for the Second Time on Inc. Magazine's List of the 5000 Fastest-Growing Private Companies in America
    Post Your Comments:
    *Name:
    *Comment:
    *Email:
    (Date:1/15/2014)... 15, 2014 TaiGen Biotechnology Company, Limited ("TaiGen") today ... R-Pharm, a leading Russian pharmaceutical company, to develop and ... Russian Federation , Turkey ... is a novel antibiotic for the treatment of bacterial ...
    (Date:1/14/2014)... Carahsoft and CDS Federal Services have scheduled a ... EST (11am PST), “Natural Language Processing: Converting Raw Data ... can turn raw, heterogeneous data into actionable knowledge to ... webinar will last approximately one hour. , Synopsis: Big ...
    (Date:1/14/2014)... , Jan. 14, 2014  3D Communications, a leading provider of strategic ... business, and media events in the United States ... associate Virginia Cox , JD, is returning to the firm,s ... Cox re-joins 3D after more than two years of service ...
    (Date:1/14/2014)... 2014 EquitiesIQ, a leading informational research ... Alliqua is an emerging biomedical company acquiring, developing, manufacturing, ... market. , Free report download: http://equitiesiq.com/reports/alliqua/ , ... management team and Board, which launched the company’s new ...
    Breaking Biology Technology:TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 2TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 3TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 4Webcast - Natural Language Processing: Converting Raw Data into Actionable Knowledge – Hosted by Carahsoft and CDS Federal Services 2Former FDA Associate Commissioner Returns To 3D Communications 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 3
    ... ... , ... Waterville, ME (Vocus) April 15, 2010 -- Cerealus Holdings, in collaboration with the ... Next Generation Strength + Retention System.” Originally patented by DuPont and later developed ...
    ... ... attendance at the Partec/Powtech/WCPT6 on April 26-29 in Nuremberg, Germany. Visit ... range including FBRM® C35, PVM® V819, and S400 laboratory probes. In ... three posters and one paper. FBRM® and PVM® technology will also ...
    ... ... reporting and ad hoc analysis , ... (PRWEB) April 13, 2010 -- Like many customer-oriented organizations, Maine Medical ... its data. The program manages behavioral healthcare for 69,000 recipients in Maine, New ...
    Cached Biology Technology:Cerealus Announces Licensing Agreement for Bio-Based Ceregel™, A Next Generation Strength and Retention System 2Track Particle Distribution in Real Time 2Track Particle Distribution in Real Time 3Maine Medical Center Chooses Business Intelligence Solution from Rapid Insight Inc. 2
    (Date:4/17/2014)... a novel method to help kidney stone sufferers ... treatment possible., Kidney stones represent a major medical ... left untreated, apart from being particularly painful, they ... In many patients treated successfully, stone recurrence is ... approach to diagnosis and treatment needs to be ...
    (Date:4/17/2014)... whereby the genetic information of DNA is used ... have numerous different functions in living organisms. Messenger ... gene expression, by relating the genetic information of ... proteins. , By examining the different types ... organism at a given time, researchers can determine ...
    (Date:4/17/2014)... View of Domestication," a special feature of The ... ( PNAS ) published April 29, raises a ... deep history that most of us take for granted. ... in many spots around the globe shifted from hunting ... and plants. , It seems so straightforward and yet ...
    Breaking Biology News(10 mins):Rapid and accurate mRNA detection in plant tissues 2Genetic study tackles mystery of slow plant domestications 2Genetic study tackles mystery of slow plant domestications 3Genetic study tackles mystery of slow plant domestications 4
    ... NYJuly 28, 2011A new study co-authored by Columbia Engineering ... Environmental Science & Technology , shows that reducing ... with "sizable" economic benefits, as well as the expected ... five scientists from around the U.S. who worked on ...
    ... -- (July 28, 2011) -- The DNA evidence is in, ... more than 1,000 Chinese tallow trees from the United States ... the tallow trees that are overrunning thousands of acres of ... widely known that Franklin introduced tallow trees to the U.S. ...
    ... the Food and Drug Administration approved a drug called ... African-American patients, claiming in a press release that this ... Invention: How Science, Politics and Big Business Re-create Race ... Roberts, the Kirkland & Ellis Professor at Northwestern University ...
    Cached Biology News:New study outlines economic and environmental benefits to reducing nitrogen pollution 2New study outlines economic and environmental benefits to reducing nitrogen pollution 3Genetic evidence clears Ben Franklin 2Genetic evidence clears Ben Franklin 3Divided by race 2
    Mouse monoclonal antibody raised against a full length recombinant CSNK2A2. NCBI Entrez Gene ID = CSNK2A2...
    ... DNA Visualizer Extraction Kit is manufactured ... causing DNA damage byexposure to UV light. ... gel is often used for DNA-cloning work. ... ethidium bromide and exposure of UV light ...
    ... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
    Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
    Biology Products: