Navigation Links
Medical Gases and Equipment Market is Expected to Reach USD 9 Billion Globally in 2018: Transparency Market Research
Date:3/20/2013

span>Japan.

Related & Recently Published Reports by Transparency Market Research

http://www.transparencymarketresearch.com/medical-specialty-bags-market.html

http://www.transparencymarketresearch.com/mobile-health-market.html

http://www.transparencymarketresearch.com/diabetes-devices-market.html

http://www.transparencymarketresearch.com/infertility-drugs-devices-market.html

http://www.transparencymarketresearch.com/rfid-in-healthcare.html

Air Liquide was the market leader in 2011 due to its extensive product portfolio and its revenue generation from the emerging Asian and Eastern European economies. Some of the other key market players include Praxair Inc., Air Products and Chemicals Inc., Matheson tri-Gas Inc., Air Gas Inc., and others.

The global medical gases and equipment market is segmented into the following categories:

Post Your Comments:
*Name:
*Comment:
*Email:
(Date:8/28/2014)... -- Next month, executives from clinical trial marketing firm BBK Worldwide ... Patient-Centered Clinical Trials 2014 , to be held at ... September 4-5. Patient recruitment experts Bonnie A. Brescia , ... share insights on the benefits of employing an effective patient ... media to mobile apps – can be used to drive ...
(Date:8/28/2014)... 28, 2014  Armetheon, Inc. ( www.armetheon.com ), ... to late-stage cardiovascular drug candidates, today announced that ... round of financing. The Series A round was ... with participation from investors that included Atheneos Capital ... Larry Hsu , the founder of Impax ...
(Date:8/28/2014)... Vt. (PRWEB) August 28, 2014 ... testing around the world is available from Strategic ... diagnostics companies. “ Industrial Microbiology Market Review, Fourth ... Industrial Market ” (IMMR—4) tracks and compares microbiology ... in North America, Europe and Asia, and forecasts ...
(Date:8/28/2014)... San Diego, CA (PRWEB) August 28, 2014 ... products, Pipette.com is offering a promotion for ... enables Pipette.com customers to purchase the highest quality ... Centrifuge Tubes are ideal for customers doing chemical, ... benefit lab technicians who are not regularly able ...
Breaking Biology Technology:BBK Worldwide Leads Sessions at Key September Events 2Armetheon Completes $7.0 Million Series A Financing 2Armetheon Completes $7.0 Million Series A Financing 32 Billion Industrial Microbiology Tests Conducted for Product Quality and Safety Worldwide 22 Billion Industrial Microbiology Tests Conducted for Product Quality and Safety Worldwide 3Eppendorf Safe Lock Centrifuge Tube Promotion Now Available at Major Pipette Distributor Pipette.com 2Eppendorf Safe Lock Centrifuge Tube Promotion Now Available at Major Pipette Distributor Pipette.com 3
... DIEGO, June 8 , , WHO: ... and panelists discussing life sciences and the business relationships between California ... , CALAsia is an international 2-day forum that will bring ... Asia Pacific region to identify, explore, and further trans-Pacific business endeavors. ...
... International, a leader in enabling and accelerating the global ... today announced a strategic drug co-development partnership with the ... of therapeutic areas and represents one of the first ... company and a Chinese university. , , HUYA ...
... June 8 CSL Limited (ASX: CSL) and Talecris Biotherapeutics, ... their merger agreement, announced on August 12, 2008, under which ... , , Dr. Brian McNamee, CEO and Managing Director ... Federal Trade Commission (FTC) resolved to block the transaction. ...
Cached Biology Technology:BIOCOM's Inaugural CALAsia Forum 'Bridging the Pacific' 2HUYA Bioscience Announces Strategic Collaboration With the Shenyang Pharmaceutical University 2HUYA Bioscience Announces Strategic Collaboration With the Shenyang Pharmaceutical University 3CSL Limited and Talecris Biotherapeutics Agree to Terminate Merger Agreement 2CSL Limited and Talecris Biotherapeutics Agree to Terminate Merger Agreement 3
(Date:8/28/2014)... (Maximizing Access to Research Careers) Program has announced ... of America,s 27th Annual Mouse Molecular Genetics Conference ... Pacific Grove, California. These awards are meant ... and scientists from underrepresented groups into the mainstream ... the participation of young scientists at the Genetics ...
(Date:8/28/2014)... Advocate and Senior Staff Attorney at the Electronic Frontier ... of biometric and mobile commerce experts set to speak ... Tampa, Florida on September 15, ... Rahman, Director, Technology and Strategy at Samsung, and Philippe de ... this year,s event is Mobility at the Crossroads of ...
(Date:8/28/2014)... good examples of complex systems. Their infrastructure equipment ... for cooling, transport to supply fuel, and ICT ... the network chain is interconnected with a wider ... team of UK-based scientists has studied various aspects ... have been published in EPJ B by Gaihua ...
Breaking Biology News(10 mins):Biometrics UnPlugged Welcomes the Electronic Frontier Foundation's Jennifer Lynch to the Mobility at the Crossroads of Commerce and Privacy Summit 2Inter-dependent networks stress test 2
... and Rongchao Jin have successfully used NMR to ... could advance the development and use of the ... approach offers a significant advantage over routine methods ... whether the nanoparticles exist in a both right-handed ...
... School have made an important discovery about the mechanism ... our understanding of how proteins regulate appetite control and ... Head of Metabolic and Vascular Health at Warwick Medical ... 1A, (CPT1) has a switch which is thrown depending ...
... aconites are plants, widely cultivated for their beauty and ... natural group of 650-700 species ranging from Eurasia into ... mountains. The study was published in the open access ... sampled molecular phylogeny for this group has revealed that ...
Cached Biology News:Carnegie Mellon researchers use NMR to determine whether gold nanoparticles exhibit 'handedness' 2Carnegie Mellon researchers use NMR to determine whether gold nanoparticles exhibit 'handedness' 3
Mouse monoclonal antibody raised against a partial recombinant DENR. NCBI Entrez Gene ID = DENR...
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... raised against a partial recombinant NFKBIB. ... 145 a.a) partial recombinant protein with GST tag. ... Accession: BC015528 ... OMIM: 604495, GeneID: ...
... Mouse polyclonal antibody raised against a ... FES (AAH35357, 120 a.a. ~ 250 ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: