Navigation Links
Max Planck Florida Institute Important to Jupiter, Waterfront Properties Says
Date:3/8/2013

JUPITER, Fla. (PRWEB) March 08, 2013

Whether it’s the free community lecture coming up March 14, the bountiful employment opportunities or the prestige of a name synonymous with the study of science, the Max Planck Florida Institute is a boon for Jupiter and the municipalities that surround it.

Less than one year after the 100,000-square-foot facility opened on Donald Ross Road near the development of Abacoa, the Max Planck Florida Institute has captured the attention of the international media, caught the eye of the German American Chamber of Commerce and the Weizmann Institute of Science in Israel, prompted a $10,000 donation from BB&T and tugged at the heartstrings of wealthy Palm Beach philanthropists.

The mission of the Max Planck Florida Institute is to study the brain and discover how it works. The results of such a monumental endeavor could lead to cures for such devastating diseases as Alzheimer’s and Parkinson’s, as well as autism and other disorders. While a number of charitable organizations exist to support patients and families of patients with those conditions, and their caregivers, the Max Planck Florida Institute focuses on high-level research in a state-of-the-art building.

According to an Enterprise Florida study, as many as 1,800 jobs will be sparked by the Max Planck Florida Institute, both directly and indirectly, during the next two decades. Direct jobs at the facility include scientific, public relations / development and administrative positions. Indirect jobs result from the opening of so-called spinoff business that serve the needs of the facility and its team of workers.

Waterfront Properties and Club Communities knows the most important impact the Max Planck Florida Institute has on Palm Beach County is in the real-estate market. Scientists have b
'/>"/>

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

Page: 1 2

Related biology technology :

1. QIAGEN and Max Planck Institute for Infection Biology Collaborate to Develop Assay for Active TB Risk in Individuals With Latent Infection
2. Waterfront Properties Proud To Have Prestigious Max Planck Society in its Back Yard
3. Fortis Offers Bachelor of Science in Nursing Degree Program to Florida Students
4. Floridas Leading Fertility Center Announces Successful Baby Delivery via Egg Freezing
5. IntelliCell BioSciences Announces Collaborative Agreement with the University of Florida on Stem Cell and Tissue Repair Research
6. University of Florida physicists set new record for graphene solar cell efficiency
7. Tropical Storm Debby Pounds Florida With Heavy Rain. Green Bean Buddy Gives Reason Why Home Owners Should Prepare For Mold Outbreaks
8. Medtech Expands Nursing Education Opportunities In Florida
9. OncoSec Secures License for Electroporation Intellectual Property from University of South Florida
10. Store-A-Tooth™ Dental Stem Cell Banking Announces Appointment of Dedicated Representative in South Florida
11. Florida-Based Team Gemini Signs Recycling Facility Agreement with Solid Waste Authority of Central Ohio
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/16/2014)... Valley, Arizona (PRWEB) September 16, 2014 ... that develops safe and effective products to treat ... the use of a proprietary SPACE™ Technology Platform ... Officer and President will present at the White ... 2014 at the Hyatt Regency Phoenix. In ...
(Date:9/16/2014)... , Sept. 16, 2014  Ascendis Pharma ... TransCon technology to address significant unmet medical needs, ... Phase 2 pediatric study to evaluate once-weekly TransCon ... or GHD.  The full interim results will be ... GRS and IGF Society, being held October 15-18, ...
(Date:9/16/2014)... According to Jeff Howell, Partner of Nidea ... new development in Downtown Toronto is expanding at a ... 755 storeys of new development last week (including three ... dominating the Toronto skyline for the foreseeable future in ... for new development. , As the Toronto city council ...
(Date:9/15/2014)... GREENBELT, Md. , Sept. 15, 2014 /PRNewswire/ ... a leading innovator of scientific products and services ... government-wide One Acquisition Solution for Integrated Services (OASIS) ... Service (FAS). GST was selected to provide the ... in the Small Business (SB) category in Pool ...
Breaking Biology Technology:Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 2Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 2Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 4ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 2ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 3Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 2Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 3
... HUBBARD, Ohio, Sept. 24 /PRNewswire-Firstcall/ -- NanoLogix, Inc. ... an exhibitor and,participant in the "Energy from Biomass ... David L. Lawrence Convention,Center in Pittsburgh, Pennsylvania September ... NanoLogix booth at the Expo, with,Dana Allen, Bret ...
... Seasoned leader brings added expertise to Shire ... England, Sept. 24, Shire plc (LSE: SHP, ... company, announced today that Sylvie,Gregoire has been ... (HGT),business, effective immediately. Sylvie brings more than ...
... BioCryst,Pharmaceuticals, Inc. (Nasdaq: BCRX ) today ... Life Sciences Conference in New York. A live ... 2007 at 2:00 p.m. Eastern,Time may be accessed ... will be archived for seven days. (Logo: ...
Cached Biology Technology:NanoLogix Inc. to Present at EBW Expo & Conference 2007 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 3Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 4BioCryst to Present at UBS 2007 Global Life Sciences Conference 2BioCryst to Present at UBS 2007 Global Life Sciences Conference 3
(Date:9/16/2014)... to make ethical choices such as buying clothing not ... fair-trade coffee, and bringing their own bags when they ... Journal of Consumer Research , ethical consumption is ... emotions about unethical practices into action. , "Advocates of ... and human costs of the products they choose, but ...
(Date:9/16/2014)... practically all vital functions in an organism. For ... particular substances and control immune system responses. Researchers ... function independently of each other, but instead form ... networks, you find many similarities with online social ... of Plant Systems Biology. "Some proteins are good ...
(Date:9/16/2014)... , Sept. 16, 2014  Cross Match Technologies, ... solutions, announced today the launch of its Verifier ... the identity of an individual using their secure ... Sentry rapidly reads credential documents with embedded biometric ... matching the biometric to a live scan of ...
Breaking Biology News(10 mins):Why are consumers willing to spend more money on ethical products? 2Good networkers make prime targets 2Cross Match Launches New Identity Management Handheld Solution 2
... Children's Hospital of Philadelphia leads a multi-center $6.7 million ... of Mental Health (NIMH) to explore a novel approach ... studies and clinical trials in adult patients, the new ... human immunodeficiency virus: sites on immune cells known as ...
... found Envisat's MERIS sensor can detect coral bleaching ... could potentially monitor impacted coral reefs worldwide on ... symbiotic algae living in symbiosis with living coral ... expelled. The whitening coral may die with subsequent ...
... what happens in cells is the work of machines that ... human and other genomes, researchers now have a nearly complete ... manual telling where all the pieces go. A new study ... to answer this question for some of the smallest and ...
Cached Biology News:Federal grant funds research on novel HIV therapy 2Federal grant funds research on novel HIV therapy 3Health of coral reefs detected from orbit 2Many needles, many haystacks 2
... Knockout System provides optimized reagents and protocols ... bacterial genes by insertion of group II ... of group II introns and utilizes a ... group II intron for specific insertion into ...
... monoclonal antibody raised against a partial recombinant MAK. ... a.a. ~ 457 a.a) partial recombinant protein with ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Biology Products: