Navigation Links
Max Institute of Minimal Access, Metabolic & Bariatric Surgery Accredited as an International Centre of Excellence for Minimal Invasive Surgery
Date:6/17/2011

RESEARCH TRIANGLE PARK, N.C., June 17, 2011 /PRNewswire/ -- Max Neeman International, leading Indian CRO, is part of the prestigious Max Group whose sister-company, Max Healthcare recently had one of 12 hospitals, 'Max Institute of Minimal Access, Metabolic & Bariatric Surgery' accredited as a Center of Excellence (COE) by the Surgical Review Corporation (SRC), USA.  The institute has become the first center in India to receive the accreditation.

(Logo: http://photos.prnewswire.com/prnh/20110105/CL25129LOGO)

The Institute's medical team is comprised of 45 people led by Dr. Pradeep Chowbey. They bring with them an accumulated experience of over 48,000 laparoscopic and bariatric surgeries spanning over two decades. The team has been at the forefront to develop and expand the frontiers of minimal access surgery in the country and beyond.

Dr. Chowbey, was featured in the Limca Book of Records from 2000 - 2009, for having performed the largest series of laparoscopic biliary surgeries (over 50,000). He has also been awarded the first honorary membership by Asia-Pacific Hernia Society and Gulf Cooperation Council Hernia Society.  The medical team is proud of having had the honor of operating on His Holiness, The Dalai Lama and His Excellency, Shri K R Narayanan, the former President of India.

As the clinical research arm of the Max Group, Max Neeman works in collaboration with Max Institute of Minimal Access, Metabolic & Bariatric Surgery to conduct minimally invasive surgery studies across multiple therapeutic areas. This collaboration provides global device and pharmaceutical companies with an integrated service offering by leveraging the combined knowledge and experience of both Max Neeman and Max Healthcare to reaffirm our commitment in setting standards of excellence in all facets of patient care.

About Max Healthcare

With over 930 beds, 12 hospitals, 1500 physicians and 3500 support staff - Max H
'/>"/>

SOURCE Max Neeman International
Copyright©2010 PR Newswire.
All rights reserved

Page: 1 2

Related biology technology :

1. David H. Murdock Research Institute Assumes Control of the Immune Tolerance Institute and Establishes a State of the Art Human Immune Monitoring Laboratory for Biomarker Discovery and Development
2. Arteriocyte and the U.S. Army Institute of Surgical Research (USAISR) Sign a CRADA to Speed Development of Cellular Therapies for Orthopaedic Trauma
3. Ontario Institute for Cancer Research Announces Spin Off Companies Developing Promising Anticancer Technologies
4. Ludwig Institute for Cancer Research and Polaris Group Form Collaboration to Expand Development of Polaris Novel Cancer Drug, ADI-PEG 20
5. Northwest Biotherapeutics and the Fraunhofer Institute for Cell Therapy and Immunology are Partnering for Clinical Trials and Compassionate Use Cases in Europe
6. Larta Institute Receives Award for National Institutes of Health Commercialization Assistance Program at 2011 Acquisition, Grants, and Small Business Symposium
7. Van Andel Institute Earns Highest "Green Building" Award
8. LifeNet Health Breaks Ground on New Institute of Regenerative Medicine
9. The Wound Institute® to Feature Educational Forum on Dynamic Reciprocity During the Symposium on Advanced Wound Care and the Wound Healing Society Annual Meeting
10. MabVax Therapeutics Receives $1.8 Million in a Phase 2 Small Business Innovation Research Program Award From the National Cancer Institute
11. IBM and The Institute of Bioengineering and Nanotechnology Find Breakthrough for MRSA Treatment
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:7/2/2015)... 2, 2015  Spherix Incorporated (Nasdaq: SPEX ) -- an ... monetization of intellectual property, today announced a litigation update. ... v. Verizon Services Corp. et al. , Case No. ... Eastern District of Virginia , the ... interpreting certain key claims in favor of the Defendants ...
(Date:7/1/2015)... ... July 01, 2015 , ... It is now possible ... using single photon emission computed tomography (SPECT) according to researchers from Amen ... examined over 20,000 brain scans and is believed to be the largest brain imaging ...
(Date:7/1/2015)... AURORA, Colo. and BANGALORE, India ... a global genomic profiling company that uses next generation ... appointment of Scott A. Storrer as chief ... and CEO, he will be responsible for all strategy, ... Vijay Chandru , who has served as Strand,s chairman ...
(Date:7/1/2015)... ... July 01, 2015 , ... A newly launched business plan contest ... the barriers to innovation in life sciences R&D. The Pistoia Alliance President’s Startup Challenge ... of US$15,000 and a period of expert mentorship from a senior industry figure drawn ...
Breaking Biology Technology:Spherix Issues A Litigation Update 2Spherix Issues A Litigation Update 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 2Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 4Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 2Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 3Pistoia Alliance Launches Startup Challenge 2Pistoia Alliance Launches Startup Challenge 3
... Children,s Health International Medicine Project of, Seattle (CHIMPS) Presented at Academic ... ... Los Angeles, CHELMSFORD, Mass., April 22 El Salvador, like ... issue of major public concern. This past fall, the El Salvadoran,government ...
... Groups of febit,s ... MEDFORD, Mass., and HEIDELBERG, Germany, April 22 febit,holding ... to,the U.S. market at RNAi World Congress, which will take ... main user groups of febit,s new device,will benefit from the ...
... AMSTERDAM, Netherlands and SANTA CLARA, Calif., April 22 ... rapidly evolving field of molecular,diagnostics, and Agilent Technologies, ... which they intend to collaborate to develop new ... an agreement in,which Agendia products will continue to ...
Cached Biology Technology:ESA LeadCare(R) System Used to Identify Salvadoran Children with Lead Poisoning 2ESA LeadCare(R) System Used to Identify Salvadoran Children with Lead Poisoning 3ESA LeadCare(R) System Used to Identify Salvadoran Children with Lead Poisoning 4febit to Introduce Geniom RT Analyzer(R) to U.S. Market at RNAi World Congress 2febit to Introduce Geniom RT Analyzer(R) to U.S. Market at RNAi World Congress 3Agendia and Agilent Announce Plans to Jointly Develop New Diagnostic Tests, Extend Supply Agreement 2Agendia and Agilent Announce Plans to Jointly Develop New Diagnostic Tests, Extend Supply Agreement 3
(Date:6/17/2015)... Maryland , and HILDEN, Germany , ... QGEN ; Frankfurt Prime Standard: QIA) today launched new ... evidence in forensic laboratories in the United States ... solution to simultaneously analyze multiple key genomic markers (short tandem ... ® Quality Sensor to evaluate the quality of DNA ...
(Date:6/17/2015)... GARDENS, Fla. , June 17, 2015 /PRNewswire/ ... solutions, today announced that its U.are.U ® ... Togo,s Eateries, Inc., a ... casual sandwich chain, to increase security, improve accountability ... fingerprint readers enable instant, non-repudiable identity confirmation for ...
(Date:6/16/2015)... NEW YORK , June 16, 2015  With ... the world, security remains a top concern. The recent ... confirms the need for strong authentication within government ... HYPR Token, a biometric one-time password (OTP) authenticator, has ... Processing Standards (FIPS) 140-2 Level 3 validation for tamper ...
Breaking Biology News(10 mins):QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 2QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 3QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 4QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 5Togo's Eateries Improve Security and Accountability with Crossmatch Fingerprint Readers 2Togo's Eateries Improve Security and Accountability with Crossmatch Fingerprint Readers 3Government Ready Biometric Security Approaching as HYPR Corp. Files FIPS 140-2 Level 3 Validation for Its Proprietary Biometric Token 2Government Ready Biometric Security Approaching as HYPR Corp. Files FIPS 140-2 Level 3 Validation for Its Proprietary Biometric Token 3
... change is one of the major challenges facing the international ... had a significant impact on the distribution of the sea ... the Arctic. There is a close connection between the Arctic ... Denmark at present is due to the polar front extending ...
... be performed successfully in 95 percent of young children ... the February 2013 issue of OtolaryngologyHead and Neck ... procedure with varying reported success rates ranging between 35 ... success in children is often perceived as lagging behind ...
... recent article in the Chronicle of Higher ... announced it was considering anonymity in the review ... ) Ge Wang, adjunct professor of biomedical ... Forest University School of Biomedical Engineering and Sciences ...
Cached Biology News:Aarhus University builds research station in North Greenland 2Aarhus University builds research station in North Greenland 3Virginia Tech adjunct and colleagues refute a study on 'racial bias' report in NIH awards 2Virginia Tech adjunct and colleagues refute a study on 'racial bias' report in NIH awards 3
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Biology Products: