Navigation Links
MEDS World, LLC Provides Multiple Environments with Designed Solutions - Wherever People Congregate, MEDS Odor Elimination Solutions Offer Eco-Friendly, Odor-Free Air
Date:6/28/2009

In 2008, Bruce Hecht and Chase Walker formed MEDS World, LLC, launching innovative odor elimination, exterior plastic trim and headlight restoration products to the Automotive, RV and Marine industries. Bruce and Chase have combined over fifty years of management experiences, in a myriad of industries, to introduce these innovative and eco-friendly products to the pan-national marketplace. You can find us here: http://www.meds-world.com

Suwanee, GA (PRWEB) June 28, 2009 -- MEDS offers multiple, scalable delivery solutions for permanent odor elimination. SNAP is a silicone free, easy to use solution for permanent exterior plastic trim restoration. RESTOREM permanently rejuvenates oxidized headlight lenses in less than 10 minutes. The MEDS automotive line of solutions increase billable services per vehicle, save time and bring increased profits to the bottom line for after-market car-care technicians and automotive detailers.

Dealerships may elect to bring these solutions in-house, adding revenues to the service drive. Ease of use and minimal training make MEDS products an attractive and inexpensive alternative to improve CSI. All MEDS automotive solutions have been approved by a leading Fortune 500 company for use in nationally franchised automotive dealerships.

In 2009, the MEDS deodorization solutions were introduced to hotels, law enforcement agencies and assisted living facilities. Our patented and scalable delivery systems have been approved and recommended by the EPA, OSHA, FDA and UK governmental agencies as effective and environmentally friendly odor elimination processes. The release of our EPA registered active-oxidant eliminates the bacterial source of odors. NSF Certified, for use in restaurants, MEDS solutions offer clean air in walk-ins and keep refrigeration units odor free. BLAS
'/>"/>

Source: PRWeb
Copyright©2009 Vocus, Inc.
All rights reserved

0

GOOD

Page: 1 2 3

Related biology technology :

1. New Probiotics Bacteria Supplier ProbioFerm, LLC Provides the Highest Quality Beneficial Bacteria Available for Product Development
2. Helix BioPharma Announces Q3 2009 Financial Results and Provides Product Development Update
3. NeurogesX Provides U.S. Regulatory Update for Qutenza(TM)
4. PDL BioPharma Provides Second Quarter 2009 Revenue Guidance of Approximately $125 Million
5. Cimzia(R) (certolizumab pegol) Provides Long-Term Remission and Response Rates in Infliximab-Refractory Crohns Patients
6. OncoGenex Pharmaceuticals Announces OGX-011 Treatment Provides Survival Benefit in Randomized Phase 2 Trial in Advanced Metastatic Prostate Cancer
7. Reorganizational Healing Provides Access to Greater Quality of Life, Reduced Stress
8. Cumberland Pharmaceuticals Provides Hospital In-Service Webcast for Acetadote(R)
9. Resverlogix Provides Quarterly Update
10. China Sky One Medical, Inc. Provides Update on Filing Form 10-K
11. Amylin Pharmaceuticals Provides Shareholders with Update Regarding Recent Developments
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/18/2013)... June 18, 2013 The human skin is ... as an important human body part. Similar to the liver, ... order to function, repair and grow. Recent reports from the ... supplements, is just as important as other life supporting organs. ... aid in skin cell reproduction, increase the appearance of skin, ...
(Date:6/18/2013)... , June 18, 2013 ... using the company,s  proprietary AMCA Guided Bone Regeneration (GBR) Dental ... implants. A common problem encountered when patients have ... of sufficient bone volume to house the implant. Consequently there ... bone substitute until the natural bone regenerates. The bone substitute ...
(Date:6/18/2013)... June 18, 2013 ... research firm, announces the initiation of full ... biopharmaceutical company developing and marketing products for ...      (Logo: http://photos.prnewswire.com/prnh/20130417/608168) ... examining the investment merits of BioAlliance Pharma, ...
(Date:6/18/2013)... , June 18, 2013 Mapi ... (APIs), generic and innovative intermediates, and finished dosage forms based ... has been granted a United States ... Europe for the oral treatment of ... is titled Intermediate Compounds and Processes for the Preparation ...
Breaking Biology Technology:Natural Acne Remedies Through Diet, Probiotic Action Shares New Insight on What Foods May Help Lead to Clear Skin 2RegeneCure Starts Clinical Study Using Polymeric Bone Stimulating Membrane for Dental Implants 2RegeneCure Starts Clinical Study Using Polymeric Bone Stimulating Membrane for Dental Implants 3Edison Expands French Healthcare Sector Coverage With Initiation of Coverage on BioAlliance Pharma 2Edison Expands French Healthcare Sector Coverage With Initiation of Coverage on BioAlliance Pharma 3Mapi Pharma Granted United States Patent for Pain Relief Medication "Tapentadol" 2
... Calif., May 8 Edwards Lifesciences,Corporation (NYSE: EW ... valves,announced that the company will celebrate a number of ... meeting of the American,Association for Thoracic Surgery (AATS), May ... by Edwards -- which this year celebrates,its 50th anniversary ...
... ALTO, Calif., May 8 Telik, Inc. (Nasdaq:,TELK) today ... per share, for,the first quarter ended March 31, 2008, ... per share, for the comparable period in 2007., ... costs and,expenses were $10.6 million, compared with $18.0 million ...
... Md., May 8 The Maryland Stem Cell,Research ... 122,applications in response to its three official Requests ... Maryland Technology Development,Corporation (TEDCO) reviewed the Commission,s recommendations ... Maryland Stem Cell Research,Fund (MSCRF) under the Maryland ...
Cached Biology Technology:Edwards Lifesciences Celebrates One Million Heart Valve Patients and More at AATS 2008 2Edwards Lifesciences Celebrates One Million Heart Valve Patients and More at AATS 2008 3Edwards Lifesciences Celebrates One Million Heart Valve Patients and More at AATS 2008 4Telik Announces First Quarter 2008 Financial Results 2Telik Announces First Quarter 2008 Financial Results 3Maryland Stem Cell Research Commission Recommends 62 Projects for Funding 2Maryland Stem Cell Research Commission Recommends 62 Projects for Funding 3
(Date:6/19/2013)... Course at the Marine Biological Laboratory (MBL), Woods ... Microbiology site by the American Society for Microbiology ... recognizes institutions and the scientists who worked there ... science of microbiology. A ceremony unveiling the ... for Saturday, June 22, 2013, at 4:30 pm ...
(Date:6/19/2013)... University of Pittsburgh has developed antibacterial compounds, derived ... be potential treatments for drug-resistant bacterial infections and ... are quite small, making them inexpensive and easy ... June 2013 issue of the journal Antimicrobial ... many probable applications will likely be the chronic ...
(Date:6/19/2013)... June 19, 2013 A decade-long JDRF-funded study ... Helmholtz Zentrum Mnchen, Germany, is providing a deeper ... risk of developing type 1 diabetes (T1D), highlighting ... for the disease. The study, "Seroconversion to Multiple ... in Children," was published today in The ...
Breaking Biology News(10 mins):Microbial diversity course designated as a 'Milestones in Microbiology' site 2HIV-derived antibacterial shows promise against drug-resistant bacteria 2New data on islet autoantibodies in young children defines early type 1 diabetes development 2
... that the loss of a gene called p63 accelerates aging ... many organisms, including humans. Therefore, the p63 gene is likely ... "To study how the p63 gene works, we devised a ... us right away was that these p63 deficient mice were ...
... study has followed a single humpback whale from one ... the migratory patterns of these majestic marine mammals in ... Society (WCS), the American Museum of Natural History (AMNH), ... Society's Biology Letters, a male humpback whale that was ...
... the introduction of the varicella (chicken pox) vaccine in ... have dropped dramatically, according to a study in the ... recommended for routine immunization of children aged 12 to ... in the United States, according to background information in ...
Cached Biology News:Gene loss accelerates aging 2Genetics links whale to two different ocean basins 2Hospitalizations because of chicken pox down dramatically since implementation of vaccine 2Hospitalizations because of chicken pox down dramatically since implementation of vaccine 3
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: