Navigation Links
LaVoie Group Adds Bio-Surgery Company, Pegasus Biologics, to Its Life Sciences Agency Roster
Date:4/27/2009

SALEM, Mass., April 27 /PRNewswire/ -- LaVoie Group, a life science-focused strategic communications agency, announced today that it has been selected as investor relations agency of record for Pegasus Biologics, Inc.

Donna L. LaVoie, President & CEO of LaVoie Group, commented, "Pegasus has the opportunity to capture the significant market share in the bio-surgery area. The Company is changing the standard of care in three initial markets: limb preservation, orthopedics, and shortly in ventral hernia repair. The addition of Pegasus underscores the increasingly diverse nature of our life sciences roster."

Michael Will, Chief Executive Officer of Pegasus Biologics, commented, "LaVoie Group has the necessary experience, skills and relationships to help capture our corporate story and articulate it to our target investor audiences. Their perspective and creative approach is already proving invaluable as we work to communicate our value proposition."

About Pegasus Biologics

Pegasus Biologics, Inc. (Irvine, CA) is a commercialization-stage company with products expected to change the standard of care in the bio-surgery solution market. Additional information on the Company can be found at http://www.pegasusbio.com.

About LaVoie Group, Inc.

LaVoie Group provides senior-level strategic counsel and tactical implementation of venture, investor and public relations programs designed to properly position, create visibility and drive value for each client. We help our life sciences companies attract capital, reach corporate partners, generate revenue and build their companies through integrated communications programs. In addition to Pegasus, our clients range from privately held development stage companies to industry leaders in life sciences such as
'/>"/>

SOURCE LaVoie Group
Copyright©2009 PR Newswire.
All rights reserved

Page: 1 2

Related biology technology :

1. Avicena Group to Present at Noble Financial Conference
2. Chrome Group to Seek Listing for Some of its Subsidiaries
3. Dr. Amit Dhawan Promoted to Medical Director for The Mattson Jack Group
4. Reed Group to Provide MDA Internet Disability Duration Guidelines to U.S. Navy
5. SportCoatings; The North American Booster Club Association (NABCA); the Coatings Specialist Group New Booster Program Goes High Tech With Invisible Antimicrobial Defense
6. Revolutionary Genomics Research Group Opens Boston Office; Provides DNA Evidence in Workers Comp Cases
7. Millennium Biotechnologies Group, Inc. (MBTG.OB) Announces Completion of $2,277,000 Equity Financing
8. ThirdBiotech Networking Group Launches
9. Millennium Biotechnologies Group, Inc. (MBTG.OB) Announces Appointment of Mark C. Mirken as its President and Chief Operating Officer
10. Reed Group Ltd. Announces Enterprise License for New Zealands Accident Compensation Corporation
11. Rosetta Genomics to Webcast Presentation at Maxim Group Growth Conference
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... Workshop Set for Sept. 3, UPPSALA, Sweden and ... Bernard de Bruyne, M.D., Ph.D., will present the,benefits of ... the outcomes of multivessel PCI in a workshop at ... The EBAC-accredited,workshop, which is sponsored by Radi Medical Systems, ...
... Cepheid (Nasdaq:,CPHD) will present at the Thomas Weisel ... Hotel, Boston, September 5 to 7, 2007. Chief,Executive ... Finance and,Chief Financial Officer, John R. Sluis will ... The webcast, along with accompanying presentation slides, may ...
... Verenium,Corporation (Nasdaq: VRNM ), a leading developer of ... high-performance specialty,enzymes, announced today that Carlos A. Riva, President ... the Cowen and Company Clean,Energy Conference. The presentation is ... 6, 2007 and will take place at Le Parker ...
Cached Biology Technology:Interventional Cardiologists Nico Pijls, Bernard De Bruyne to Discuss Benefits of Measuring Coronary Pressure in Improving Multivessel PCI at ESC Congress 2007 2Cepheid to Present at Thomas Weisel Partners Healthcare Conference 2Verenium Corporation to Present at the Upcoming Cowen and Company Clean Energy Conference 2Verenium Corporation to Present at the Upcoming Cowen and Company Clean Energy Conference 3
(Date:9/18/2014)... rabbitfish which have devastated algal forests in the eastern ... Mediterranean basin if their distribution continues to expand as ... by an international team of researchers led by Dr ... of the Mediterranean Institute for Advanced Studies in Spain, ... Members of the team surveyed more than 1000 kilometres ...
(Date:9/18/2014)... the ultimate form of camouflage: you don,t just blend ... is not as uncommon as you might think. Kathryn ... explains that the larval life stages of many marine ... the anatomy that most creatures cannot make transparent. Feller ... shield each individual eye unit with an opaque pigment ...
(Date:9/17/2014)... for the Arts and Humanities has received a $260,000 ... two-year project, "The Boundaries of the Human in the ... support a wide-ranging series of events aimed at exploring ... involves artists and researchers who are exploring the boundaries ... of humanism, and the other involves the increasingly influential ...
Breaking Biology News(10 mins):Tropical fish a threat to Mediterranean Sea ecosystems 2Transparent larvae hide opaque eyes behind reflections 2Mellon Foundation awards grant for major project in the humanities and sciences 2
... the immune system, a line of genetically engineered mice can ... of Medicine in St. Louis have found. , Scientists ... system component, a group of molecules known as the Major ... that is similar enough to step in and fill the ...
... to exist and even thrive in surroundings ranging from ... from the Weizmann Institute's Plant Sciences Department, led by ... just two amino acids (the building blocks of protein) ... temperatures and being adapted to living in extreme heat. ...
... has found that large segments of the Pacific Ocean ... the absence of the mineral stresses these microscopic ocean ... ocean productivity appear more robust than it really is. ... data may be inaccurate, the researchers say, and the ...
Cached Biology News:Mice lacking key immune component still control chronic viral infections 2Mice lacking key immune component still control chronic viral infections 3Bacteria beat the heat 2Iron critical to ocean productivity, carbon uptake 2Iron critical to ocean productivity, carbon uptake 3
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: