Navigation Links
Journal of Medical Imaging will Launch in 2014
Date:9/12/2013

ns of these technologies have helped save lives through better diagnosis and less invasive treatments, and the field keeps expanding to meet more needs. Supporting the community with a home journal is a significant step forward.”

“SPIE is delighted to be able to respond to the needs expressed by the medical imaging community, in particular authors who currently participate in the Medical Imaging symposium. The new journal will provide them a rigorous, peer-reviewed option for their work and help maintain and foster the already well-established connections within the community,” said SPIE Publications Director Eric Pepper.

Because it is open to submissions internationally, JMI will also serve to strengthen connections and facilitate collaboration among researchers in academia, medical institutions, industry, and government labs throughout the larger imaging community, Giger said.

About SPIE

SPIE is the international society for optics and photonics, a not-for-profit organization founded in 1955 to advance light-based technologies. The Society serves nearly 235,000 constituents from approximately 155 countries, offering conferences, continuing education, books, journals, and a digital library in support of interdisciplinary information exchange, professional networking, and patent precedent. SPIE provided over $3.2 million in support of education and outreach programs in 2012.

Read the full story at http://www.prweb.com/releases/2013/9/prweb11118874.htm.


'/>"/>
Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

Page: 1 2

Related biology technology :

1. Nucleic Acids Research Journal Publishes Sapphire Energy Peer-Reviewed Research Paper on a Chloroplast Genome From Green Algae
2. Elsevier and Federation of Biochemical Societies Launch New Journal: FEBS Open Bio
3. BioStorage Technologies Mike Reffeitt Named "CFO of the Year" by Indianapolis Business Journal
4. 2011-2012 Michael E. DeBakey Journalism Award Winners Announced
5. Elsevier Launches New Journal: Learning, Culture and Social Interaction
6. Journal of Renewable and Sustainable Energy highlights energy trends in China
7. Elsevier to Participate in SCOAP3 With the Journals Physics Letters B and Nuclear Physics B
8. Elsevier Launches International Journal for Parasitology: Parasites and Wildlife
9. Published Findings In Human Gene Therapy Methods Journal Demonstrate Cardiums New Catheter-Based Method Significantly Boosts Gene Delivery To The Heart
10. Glencoe Software and The Journal of Cell Biology Pioneer Publishing of Massive, Ultra-Resolution Images
11. Elsevier Launches New Journal: Performance Enhancement & Health
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:3/27/2015)... NEW YORK , March 27, 2015  Peter ... in Biomedical Science for his pioneering work on how ... the components of a regulatory mechanism that cells use ... proteins. Dr. Walter is a professor of biochemistry at ... the groundwork for treating a range of human diseases ...
(Date:3/27/2015)... March 27, 2015 WuXi PharmaTech (Cayman) ... R&D capability and technology platform company serving the ... today that an Investigational New Drug (IND) application ... rheumatoid arthritis has been accepted for review by ... In September 2012, MedImmune, the global ...
(Date:3/27/2015)... Buffalo, New York (PRWEB) March 27, 2015 ... of the 2015 application period for 43North - the ... cash prizes, including a grand prize of $1 million, ... attracts entrepreneurs from around the world to compete for ... into funded enterprises in the Western New York region. ...
(Date:3/26/2015)... San Bruno, CA (PRWEB) March 26, 2015 ... organization (CRO), announced today several management and executive ... role of Chief Financial Officer (CFO) and member of ... Vice President of Business Operations, and Sue Dowden will ... Tony Taricco, co-founder and current Chief Operations Officer (COO), ...
Breaking Biology Technology:German-born cell biologist Peter Walter wins the 2015 Vilcek Prize in Biomedical Science 2German-born cell biologist Peter Walter wins the 2015 Vilcek Prize in Biomedical Science 3Investigational New Drug Application for WuXi MedImmune's Monoclonal Antibody Accepted for Review by CFDA 2Investigational New Drug Application for WuXi MedImmune's Monoclonal Antibody Accepted for Review by CFDA 3Governor Andrew M. Cuomo Anounces Launch of Year Two of World's Largest Business Idea Competition and Opening of New Incubator Space in Buffalo, New York 2Governor Andrew M. Cuomo Anounces Launch of Year Two of World's Largest Business Idea Competition and Opening of New Incubator Space in Buffalo, New York 3Governor Andrew M. Cuomo Anounces Launch of Year Two of World's Largest Business Idea Competition and Opening of New Incubator Space in Buffalo, New York 4Governor Andrew M. Cuomo Anounces Launch of Year Two of World's Largest Business Idea Competition and Opening of New Incubator Space in Buffalo, New York 5PRC Clinical Announces Key Management Appointments and Launches East Coast Operations 2PRC Clinical Announces Key Management Appointments and Launches East Coast Operations 3
... -- Engineers at Ohio State University are developing a ... same material found in pencils. , Experts believe that ... graphite pencils -- holds the key to smaller, faster ... could enable new kinds of electronics. , Until now, ...
... March 31 Alseres Pharmaceuticals, Inc. (Nasdaq: ... of the Company,s independent registered public accounting firm ... explanatory paragraph regarding the Company,s ability to continue ... NASDAQ-traded companies to publicly announce if their Annual ...
... after heart attackAUSTIN, Texas, March 31 /PRNewswire/ ... Austin treated the first patient in the world ... test the effectiveness and safety of administering adult stem ... heart attack. Dr. Roger Gammon, a cardiologist with ...
Cached Biology Technology:Researchers find better way to manufacture fast computer chips 2Researchers find better way to manufacture fast computer chips 3Alseres Pharmaceuticals, Inc. Complies with NASDAQ Rule Regarding Recently Filed 10-K 2Alseres Pharmaceuticals, Inc. Complies with NASDAQ Rule Regarding Recently Filed 10-K 3Heart Hospital of Austin First Site in World to Test Efficacy of New Adult Stem Cell Therapy to Treat Damaged Heart Tissue in Phase II Trial 2
(Date:3/12/2015)... March 12, 2015 The mascots of the ... Hospital, part of Wake Forest Baptist Medical Center. They ... the 2015 ACC Men,s Basketball Tournament. Young patients enjoyed ... and getting their autographs. Brenner Children,s Hospital ... is the only children,s hospital in northwest ...
(Date:3/11/2015)...   The Sync Project™ today announced ... and harness music to improve health. The platform ... measurements of physiology, enabling the study of the ... populations. It is designed for medical and health ... studies and accelerate the discovery of the clinical ...
(Date:3/10/2015)...  NXT-ID, Inc. (NASDAQ: NXTD ... authentication company focused on the growing mobile commerce ... been named the "Number One Best Tech Gift ... Modern ( http://www.rethinkmodern.com/ ) is a web magazine focused ... that have a unique function or design.  ...
Breaking Biology News(10 mins):Introducing The Sync Project, a Global Collaboration Harnessing the Scientific Potential of Music for Health 2Introducing The Sync Project, a Global Collaboration Harnessing the Scientific Potential of Music for Health 3NXT-ID's Wocket Smart Wallet Named Number One Best Tech Gift for 2015 by Rethink Modern 2NXT-ID's Wocket Smart Wallet Named Number One Best Tech Gift for 2015 by Rethink Modern 3NXT-ID's Wocket Smart Wallet Named Number One Best Tech Gift for 2015 by Rethink Modern 4
... MADISON, WI, SEPTEMBER 21, 2009 A new ... , documents the history, science, and applications of tall ... increasing role in protecting soil and water and enhancing ... from around the world who address an array of ...
... after plucking the fossilized tooth of a new human ... team of scientists today (Thursday, Oct. 1) announced their ... Ardipithecus ramidus , which they say revolutionizes our understanding ... female skeleton, nicknamed Ardi, is 4.4 million years old, ...
... African bees were accidentally released in Brazil in 1957. ... at the Smithsonian Tropical Research Institute, began a 17-year ... to native bees than changes in the weather and ... , Scientists feared that dangerous swarms of Africanized bees ...
Cached Biology News:Tall fescue's future in agriculture 2Ardi displaces Lucy as oldest hominid skeleton 2Ardi displaces Lucy as oldest hominid skeleton 3Ardi displaces Lucy as oldest hominid skeleton 4Ardi displaces Lucy as oldest hominid skeleton 5Killer bees may increase food supplies for native bees 2
... Mouse polyclonal antibody raised against a ... FES (AAH35357, 120 a.a. ~ 250 ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: