Navigation Links
Jazz Pharmaceuticals, Inc. Announces Fourth Quarter and Full Year 2007 Financial Results
Date:2/13/2008

on to update any forward-looking statements contained in this release as a result of new information, future events or changes in its expectations.

JAZZ PHARMACEUTICALS, INC.

CONSOLIDATED STATEMENTS OF OPERATIONS

(In thousands, except per share amounts)

(Unaudited)

Three Months Ended Year Ended

December 31, December 31,

2007 2006 2007 2006

Revenues:

Product sales, net $14,860 $11,890 $53,536 $43,299

Royalties, net 332 258 1,156 594

Contract revenue 285 301 10,611 963

Total revenues 15,477 12,449 65,303 44,856

Operating expenses:

Cost of product sales

(excluding amortization of

acquired developed

technology) 3,283 1,601 8,903 6,968

Research and development 20,540 13,036 69,792 54,956

Selling, general and

administrative 27,958 12,543 78,540 51,384

Intangible asset

amortization 2,280 2,400 9,217 9,600

Intangible asset impairment 20,160 - 20,160 -

Provision for government

settlement - - 17,469 -

Total operating expenses 74,221 29,580 204,081 122,908

Loss from operations (58,744) (17,131) (138,778) (78,052)

Interest income 1,582 619 5,942 2,307

Interest expense (3,554) (3,311) (13,647) (14,129)

Other income (expense)
'/>"/>

SOURCE Jazz Pharmaceuticals, Inc.
Copyright©2008 PR Newswire.
All rights reserved

0

GOOD

Page: 1 2 3 4 5 6 7 8 9

Related biology technology :

1. Drug Royalty Corporation (DRC) Announces Acquisition Regarding PEG-INTRON(R) From Enzon Pharmaceuticals, Inc. (ENZN)
2. Prestwick Pharmaceuticals, Inc. Continues to Build Management Team With Appointment of Martin Stogniew, Ph.D. as Executive Vice President, Chief Technology Officer
3. Keryx Biopharmaceuticals, Inc. Announces Appointment of Michael P. Tarnok to Board of Directors
4. Keryx Biopharmaceuticals, Inc. Announces Conference Call to Discuss Strategic Alliance
5. Keryx Biopharmaceuticals, Inc. Enters into Licensing Agreement with Japan Tobacco and Torii Pharmaceutical for Development and Commercialization of Hyperphosphatemia Drug in Japan
6. NPS Pharmaceuticals, Inc. Announces an Increase in Tender Offer Price for Its 3.0% Convertible Notes Due 2008 and Extends Expiration Date Until October 17, 2007
7. Alseres Pharmaceuticals, Inc. to Present at Bio Investor Forum 2007 Annual Meeting
8. Jazz Pharmaceuticals, Inc. Announces Changes to its Board of Directors
9. Alseres Pharmaceuticals, Inc. to Present at Windhovers Therapeutic Area Partnerships Conference
10. Keryx Biopharmaceuticals, Inc. to Hold Conference Call on Third Quarter 2007 Financial Results on Thursday, October 25, at 8:30 A.M. EDT
11. Jazz Pharmaceuticals, Inc. to Announce Third Quarter 2007 Financial Results on November 6, 2007
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/19/2013)... 19, 2013  Continuing its long history of proven ... Beckman Coulter , Inc. announces the U.S. Food and ... AccuTnI+3 troponin I assay for use on its Access ... on Beckman Coulter,s troponin I test for ... the proven performance to continue providing dependability to laboratories ...
(Date:6/19/2013)... Bayer CropScience will honor Illinois beekeeper Steve McNair ... Award. The award will be announced at Bayer’s ... an event where supporters of pollinator health celebrate the ... , The Bayer Bee Care Community Leadership Award recognizes ... bee colony to benefit their community. Applicants are judged ...
(Date:6/19/2013)... LOS ANGELES , June 19, 2013 Biotechnology ... is teaming up with financial software provider BlackLine Systems ... (NYSE: SAP ) for a webinar next week ... Amgen Uses Solutions from BlackLine and SAP to Help Keep ... (Logo: http://photos.prnewswire.com/prnh/20061117/LAF027LOGO ) The webinar, ...
(Date:6/19/2013)... Indiana (PRWEB) June 19, 2013 ... joined the speaking faculty at 2013’s BioLogistics Summit ... The conference, coordinated by Cold Chain IQ and ... biologics. This “complexity” is, in part, attributed to ... , “Implicit within these trends is an ...
Breaking Biology Technology:Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 2Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 3Community Mentor Wins Inaugural Bayer CropScience Bee Care Leadership Award 2Community Mentor Wins Inaugural Bayer CropScience Bee Care Leadership Award 3Community Mentor Wins Inaugural Bayer CropScience Bee Care Leadership Award 4Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 2Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 3Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 4BioConvergence® Presents at BioLogistics Summit on Risk Matrix for Biosamples during Shipment 2
... MOUNTAIN VIEW, Calif., Jan. 17, 2012  MAP Pharmaceuticals, Inc. (Nasdaq: ... James O,Shea to its Board of Directors. Mr. O,Shea brings ... product commercialization and operations. "We are privileged to ... time in the Company,s development as we focus our efforts ...
... 16, 2012 Luminex Corporation (Nasdaq: LMNX ) ... fourth quarter and full year 2011 on Monday, February 6, ... release after the close of trading. (Logo: ... conference call to discuss the operating highlights and financial results ...
... 2012 Elsevier, a world-leading provider ... services, announced today that its first bilingual platform of ... , is now available online. NursingChina ... available in China, featuring skills within specialties such ...
Cached Biology Technology:MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 2MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 3Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 2Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 3Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 2Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 3
(Date:6/19/2013)... MOUNTAIN VIEW, Calif. , June 20, 2013 ... the personalized cosmeceuticals market, Frost & Sullivan recognizes ... Sullivan Award for New Product Innovation. geneOnyx leverages ... point-of-care testing to create an on-the-spot genetic test ... only a single-step DNA collection procedure from saliva ...
(Date:6/19/2013)... is playing a vital role in the survival of ... to climate and environmental changes, according to new research ... savannah birds from the Tanzanian Bird Atlas project - ... - the researchers found that they are using protected ... further west where dry seasons are getting longer, with ...
(Date:6/19/2013)... 19, 2013   Mercy Medical Center ... technology for conducting on-demand, Hemoglobin A 1c ... well as analysis of important red blood ... The new system enables the hospital to ... physicians and their patients, which can improve ...
Breaking Biology News(10 mins):Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 2Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 3Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 4Protected areas provide African birds with stepping stones to survival 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 3Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 4
... in biomedical science are on the horizon with ... Infrastructure (Instruct) in support of European biomedical research. ... (ESFRI) is involved in establishing about 40 such ... is one such biomedical project, whose aim is ...
... center responsible for responding goes into gear, setting off a ... from the adrenal glands. Dr. Gil Levkowitz ... now revealed a new kind of ON-OFF switch in the ... from the brain that stimulates cortisol release in the body. ...
... by a University of California, Davis, plant scientist delivers a ... world-renowned wine industry. The study is set for publication ... the Proceedings of the National Academy of Sciences. "Many ... plant, but we believe that most microbes would have difficulty ...
Cached Biology News:European Integrated Structural Biology Infrastructure launching 2A unique on-off switch for hormone production 2Fused genes tackle deadly Pierce's disease in grapevines 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: