Navigation Links
January Market Jitters Fails to Derail Biotech
Date:2/1/2008

SAN FRANCISCO, Feb. 1 /PRNewswire/ -- Fears that the economy is not only heading towards a recession but is also rapidly weakening had investors in a skittish mood during January. However, biotech held steady with the Burrill Biotech Select Index closing unchanged well ahead of the NASDAQ, which posted a January loss of 9.9%, and the Dow, which closed down 4.6%.

"Healthcare is usually able to ride out extremely volatile capital markets with less damage because they are viewed as 'safe' stocks in recession periods," said G. Steven Burrill, CEO of Burrill & Company a San Francisco based global leader in life sciences whose principal activities are in Private Equity, Venture Capital, Merchant Banking and Media, "and biotech, on a relative basis, performed well in January." Helping the cause was the buzz created around the JPMorgan's 26th Annual Healthcare Conference, which continues to set records for attendance during the four day San Francisco-based event. Many of the 300-plus companies, which presented at the event were reporting updated clinical and year end results ... and the mood was quite optimistic.

Most notable was Pharmasset, whose shares surged to close the month up 87%. Early in January the company announced positive data from a short-term Phase I study on its hepatitis C candidate, R7128. The four-week trial assessed two doses of Pharmasset's R7128 in combination with the standard of care, Pegasys plus Copegus, in 50 chronically infected patients who hadn't received prior treatment. Pharmasset said 85% of patients given the higher dose, 1,500 milligrams, and 30% at the lower 500 milligram dose had undetectable levels of the virus after four weeks. In comparison, only 10% of patients on the placebo, which was standard of care alone, achieved undetectable levels of the virus.

Pharmasset was the only bright spot amongst a sea of decliners in the Burrill Mid-Cap Biotech Index group as shares of these companies got dragged down with
'/>"/>

SOURCE Burrill & Company
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2 3 4

Related biology technology :

1. Correction to Press Release Dated January 31, 2008: Inverness Medical Innovations to Participate at 2008 Merrill Lynch Global Pharmaceutical, Biotechnology and Medical Device Conference on February 5, 2008
2. Abaxis to Report Third Quarter Fiscal 2008 Financial Results Thursday, January 31, 2008
3. Exelixis Announces January 31 Webcast of Presentation at the 2008 Wachovia Healthcare Conference
4. Hologic, Inc. to Release First Quarter Fiscal 2008 Operating Results Thursday, January 31st Before Market Opens
5. Bristol-Myers Squibb to Announce Results for the Fourth Quarter and Full Year of 2007 on January 31
6. ARCA Discovery, Inc. to Present at 26th Annual JPMorgan Healthcare Conference on January 8, 2008
7. Exelixis Announces January 10 Webcast of Presentation at the 26th Annual JPMorgan Healthcare Conference
8. Inverness Medical Innovations to Participate at JP Morgan Healthcare Conference on January 8, 2008
9. LifeCell Corporation Schedules 2008 Financial Guidance Release and Conference Call; January 7, 2008 at 10:00 A.M. Eastern
10. BioForm Medical to Present at the 2008 JPMorgan Healthcare Conference on January 7, 2008
11. Stryker to Host Conference Call on January 23, 2008
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/22/2014)... 21, 2014   ... Commercial Officer zu KLOX    ... Chief Financial Officer bestellt    KLOX ... seines jüngst zugelassenen Behandlungssystems zur Wundheilung zu beginnen    ... "Unternehmen") ist sehr erfreut, die folgenden personellen Veränderungen anzukündigen: ...
(Date:11/21/2014)... BELLINGHAM, Washington, USA (PRWEB) November 19, 2014 ... used in our lives was shared with more than ... undergraduate and postgraduate students from the University of Otago ... Outreach Grant . The Otago students, members of the ... Southland New Zealand in early September, giving children from ...
(Date:11/21/2014)... 20, 2014 The California ... research organization representing leading California academic institutions, biotechnology, ... PwC US today released a report revealing ... industry growth. The trend shows a 4 percent ... California Biomedical Industry Report indicates that, while ...
(Date:11/21/2014)... Fayetteville, Arkansas (PRWEB) November 20, 2014 ... partners, Pinnacle Ozone Solutions, LLC (Pinnacle), and PCI, ... equipment, announced that they have been selected to ... City of Fayetteville, Arkansas Paul R. Noland Wastewater ... feature BlueInGreen’s patented HyDOZ® gas dissolution ...
Breaking Biology Technology:KLOX Technologies meldet Neubesetzung von Führungspositionen 2KLOX Technologies meldet Neubesetzung von Führungspositionen 3KLOX Technologies meldet Neubesetzung von Führungspositionen 4KLOX Technologies meldet Neubesetzung von Führungspositionen 5Optics and photonics outreach programs share science, spark fascination with light 2Optics and photonics outreach programs share science, spark fascination with light 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 2California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 4City of Fayetteville Leads Nation with Innovative Ozone Technology 2City of Fayetteville Leads Nation with Innovative Ozone Technology 3City of Fayetteville Leads Nation with Innovative Ozone Technology 4
... veteran, was promoted to president of the General Electric Medical ... who left to become CEO at Invitrogen. The division focuses ... systems . , ,It's a dream job for a corporate ... about $9 billion and produced GE CEO and Chairman Jeffery ...
... develops and sells employee scheduling and management products. The ... and co-founder of Suite Scheduler, a former nurse manager ... employees in a facility. , ,Suite Scheduler products are ... up to 90% of the time to create and ...
... That is, until he gets to the better drugs, faster ... the science behind the Madison-based companys products is likely to ... nears the age when diseases and treatments become as common ... the two and a half-year-old company that Vodenlich joined as ...
Cached Biology Technology:CEO Wilson Defines GE's Health-IT Customer 2CEO Wilson Defines GE's Health-IT Customer 3CEO Wilson Defines GE's Health-IT Customer 4Scheduling made easy with Suite Scheduler 2Scheduling made easy with Suite Scheduler 3Chipping Away at Drug Development 2Chipping Away at Drug Development 3
(Date:11/18/2014)... , Nov. 18, 2014   EyeLock Inc. ... solutions, and MorphoTrust USA (Safran), a ... today announced a strategic partnership to offer comprehensive ... vehicle administration (MVA), airport screening and financial services ... solutions, MorphoTrust serves consumers through a nationwide network ...
(Date:11/11/2014)... , Nov. 11, 2014  Forensicon, Inc., a ... firm, is pleased to announce the promotion of ... Director of Digital Forensics. In Schiff,s new role as ... the team of digital forensics examiners and provide leadership ... Photo - http://photos.prnewswire.com/prnh/20141110/157719 ...
(Date:11/7/2014)... Calif. , Nov. 7, 2014  In conjunction with ... Police Departments, The Community Foundation of the Verdugos ... DNA JUSTICE PROJECT," a $250,000 initiative to keep ... initial phase. In its first six months of existence, the ... needed evidence support for local law enforcement. "Because ...
Breaking Biology News(10 mins):EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 2EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 3Yaniv Schiff Promoted to Director of Digital Forensics at Forensicon, Inc. 2Community Foundation Of The Verdugos Unveils Campaign To Fund Glendale-Burbank DNA Justice Project 2
... February 26, 2013, New York, N.Y. and San Diego, Calif. ... tumor in adults, is challenging to treat because the tumors ... more about the causes of tumor cell growth and drug ... new targeted therapies to potentially treat this deadly cancer. ...
... 2013, Reston, VAResearchers will meet at the Society of ... a number of health concerns that have received growing ... of the presentations, scientists will explore how the development ... related exposures might affect the risk assessment of arsenic ...
... Rockville, Md. The Association for Research in Vision ... three keynote speakers, including two Nobel laureates, during the ... Wash. New this year, the ARVO/Alcon Keynote Series ... Christopher Murray, MD, DPhil. Smithies, of the University ...
Cached Biology News:Novel combination therapy shuts down escape route, killing glioblastoma tumor cells 2Scientists explore topical health issues at meeting in Texas 23 distinguished keynote speakers to present during ARVO 2013 Annual Meeting 2
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... sufficient materials for 1,464 array sample elements. , , ... , Blocker BSA in PBS (10X): 50 ml ... BupH Phosphate Buffered Saline: 8 packs , 10% ... Pico Luminol Enhancer: 2 x 25 ml , SuperSignal ...
Biology Products: