Navigation Links
Isis Pharmaceuticals Adds Two New Drugs to Development Pipeline
Date:1/6/2011

CARLSBAD, Calif., Jan. 6, 2011 /PRNewswire/ -- Isis Pharmaceuticals, Inc. (Nasdaq: ISIS) announced today that it has added two new drugs to its development pipeline, ISIS-FGFR4Rx and ISIS-STAT3Rx.  

ISIS-FGFR4Rx is designed to treat obesity by increasing metabolism, particularly by increasing lipid and fat burning.  ISIS-FGFR4Rx specifically blocks the production of fibroblast growth factor receptor 4 (FGFR4) in the liver and fat tissue. In addition, ISIS-FGFR4Rx should not reduce FGFR4 expression in the central nervous system (CNS) or heart, thereby avoiding the CNS and cardiovascular side effects associated with many obesity drugs in development.  In preclinical studies, inhibition of FGFR4 lowered body weight and enhanced weight loss when administered as a single agent, in combination with a caloric-restricted diet and in combination with an appetite-suppressing drug and a caloric-restricted diet.  The reduction in body weight was accompanied by an improvement in insulin sensitivity. ISIS-FGFR4Rx was safe and well tolerated in multiple species.  ISIS-FGFR4Rx is the first drug in Isis' metabolic franchise to treat obesity.  

"Obesity has become an epidemic.  It is a condition that increases the risk of diabetes, heart disease, stroke, arthritis and some cancers, and an area where most centrally acting drugs have failed due to side-effects.  Consequently, our peripherally acting drugs such as ISIS-FGFR4Rx could have significant therapeutic benefit without the associated central nervous system toxicities that plague many other anti-obesity drugs.  Our ability to selectively target FGFR4 in only the tissues where FGFR4 plays an important role in modulating body weight, makes it an ideal target for our antisense technology," said Sanjay Bhanot, M.D., Ph.D., Vice President, Metabolic Disorders and Head of Translational Medicine
'/>"/>

SOURCE Isis Pharmaceuticals, Inc.
Copyright©2010 PR Newswire.
All rights reserved

0

GOOD

Page: 1 2 3 4

Related biology technology :

1. Onyx Pharmaceuticals to Present at the 29th Annual J.P. Morgan Healthcare Conference
2. Keryx Biopharmaceuticals to Present at 29th Annual J.P. Morgan Healthcare Conference
3. Pier Pharmaceuticals Names Peter Letendre as Chief Executive Officer, President and Director
4. Optimer Pharmaceuticals to Present at the 29th Annual J.P. Morgan Healthcare Conference
5. Pittsburgh-based BIOSAFE Receives EPA Registration and Enters Into Commercialization Agreement with Union Springs Pharmaceuticals
6. Access Pharmaceuticals Raises $6.0 Million In Registered Direct Offering
7. University of Utah and Navigen Pharmaceuticals Announce a New Government Contract to Advance Slit2N for the Treatment of Hemorrhagic Fever and Anthrax Exposure
8. Onyx Pharmaceuticals Announces Positive Complete Results From Carfilzomib Phase 2b Study
9. AVANIR Pharmaceuticals Announces Proposed Public Offering of Common Stock
10. Keryx Biopharmaceuticals to Present at Lazard Capital Markets 7th Annual Healthcare Conference
11. Oramed Pharmaceuticals Presents Results of its Phase IIb Clinical Trial at the Diabetes Technology Meeting 2010 in Bethesda, MD
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/18/2013)... WILMINGTON, Delaware , June 18, 2013 /PRNewswire/ ... to announce the release of the HELM biomolecular ... permissive open source MIT licence. HELM ... of a wide range of biomolecules (e.g. proteins, ... render existing small-molecule and sequence-based informatics methodologies impractical ...
(Date:6/18/2013)... -- The "Bioinformatics Market By Sector (Molecular Medicine, Agriculture, ... Data Analysis Services) & Application (Genomics, Proteomics & Drug Design) - Global ... Restraints, and Opportunities in North America , ... and Rest of World. Browse , ... Figures 364 Pages and an in-depth ...
(Date:6/18/2013)... , June 18, 2013 ... ) has announced the addition of the ... and Companies " to their offering. ... report briefly reviews basics of human genome ... applications. Current large and small sequencers are ...
(Date:6/18/2013)... DUBLIN , June 18, 2013 ... Markets ( http://www.researchandmarkets.com/research/cmbgcv/north_american ) has announced ... American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes ... Radiation Therapy (I131, Y-90)], [Applications (Cancer/Oncology, ... to 2017" report to their ...
Breaking Biology Technology:The Pistoia Alliance Releases HELM Biomolecular Representation Standard Open Source Tools 2Bioinformatics Market Worth $7.5 Billion by 2017 2Bioinformatics Market Worth $7.5 Billion by 2017 3DNA Sequencing: Technologies, Markets and Companies - 2013 Report 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 3
... that allow nanoparticles to assemble themselves into designer materials ... of Iowa State University and the Ames Laboratory reports ... Science . Travesset, an associate professor of physics ... of Energy,s Ames Laboratory, writes in the journal,s Perspectives ...
... today announced that Jeff Liter has been appointed as ... "Jeff,s diverse background in all aspects of corporate development ... Said Matt McManus, President and CEO, PrimeraDx.  "PrimeraDx,s strategy ... Plex system in the MDx market and define ...
... from the Faculty of Biology and Biotechnology at the ... of Biological Chemistry explaining why enzymes used for ... In collaboration with researchers from Berlin, they used spectroscopic ... that lead to the inactivation of the enzyme,s iron ...
Cached Biology Technology:Iowa State, Ames Lab physicist says nanoparticle assembly is like building with LEGOs 2PrimeraDx Appoints Jeff Liter as VP of Corporate Development 2If oxygen becomes the undoing of proteins 2
(Date:6/18/2013)... Kingdom, the Energy Department,s National Renewable Energy Laboratory ... published a paper describing a novel cellulose-degrading enzyme ... , commonly known as the gribble. , ... relatively unique ability to produce their own enzymes ... the biomass they eat. New biomass-degrading enzymes from ...
(Date:6/18/2013)... not a hacker lab. At Brandeis University, sophisticated ... are helping scientists understand the complex interplay between ... the virus, outer "shell" critical for replication. ... what we are finding will help researchers alter ... post-doctoral fellow Jason Perlmutter, first author of the ...
(Date:6/18/2013)... Torrent, Ph.D., Medical Research Council, Laboratory of Molecular ... a 2013 ICAAC Young Investigator Award. Torrent is ... developing the first algorithm to predict antimicrobial regions ... said, "we are now applying this algorithm to ... antimicrobial peptide leads with very appealing results." ...
Breaking Biology News(10 mins):Novel enzyme from tiny gribble could prove a boon for biofuels research 2Computer modeling technique goes viral at Brandeis 2The American Society for Microbiology honors Marc Torrent 2
... could help ships sailing smoothly. The growth of marine ... major cause of increased energy costs in the naval ... this so called 'bio-fouling'. , Ralph Liedert from the ... work on the application of artificial shark skin in ...
... that provides a vital passage through a bacterium's outer ... is built of the 'wrong' material, scientists at The ... a finding that has long-term implications for understanding diseases ... disease, and mad cow disease. , The paper in ...
... of different items by scanning the tiny barcode printed ... could make it just as easy to identify genes, ... tagging them with color-coded probes made out of synthetic ... Luo, Cornell assistant professor of biological engineering, has created ...
Cached Biology News:Beyond genes: Lipid helps cell wall protein fold into proper shape 2Beyond genes: Lipid helps cell wall protein fold into proper shape 3Tagging pathogens with synthetic DNA 'barcodes' 2Tagging pathogens with synthetic DNA 'barcodes' 3
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... The user-friendly Eppendorf Thermomixer R offers ... that require shaking, heating, and cooling. ... expanded its application and temperature control ... each accommodate 24 micro test tubes, ...
...
Biology Products: