Navigation Links
Interleukin Genetics Reports Third Quarter 2008 Financial Results
Date:11/13/2008

University offset by a decrease in consulting related expenses.

Selling, general and administrative expenses were $1.6 million for the third quarter of 2008 compared to $1.2 million for the same period last year. The increase is primarily attributable to increased promotional and advertising activities in both the personalized health segment and the consumer products segment, in addition to increased compensation expenses due to increased headcount.

On September 30, 2008, the Company had cash and cash equivalents of $5.9 million compared to $7.6 million of cash and cash equivalents on December 31, 2007. In addition, the Company has access to $10.3 million under credit facilities with Alticor, which permit borrowing until March 31, 2009.

Third Quarter and Recent Highlights

-- Entered into a Research and License Agreement with Geisinger Health System: In September 2008, Interleukin Genetics and Geisinger announced a collaboration permitting Interleukin Genetics to utilize Geisinger's databases to develop a series of genetic tests that will help physicians better understand an individual's inherited resistance to weight loss and gauge a patient's likelihood of success with diet and other weight loss techniques.

-- Revised Exclusive License Agreement with Alticor Corporation's Access Business Group International, LLC (ABG): In September 2008, Interleukin Genetics and ABG amended the companies' existing agreement to expand Interleukin Genetics' distribution network for genetic tests jointly developed by the two companies. The revised agreement permits the Company to sell products through additional channels of its choosing.

-- Licensed PST Genetic Test to OralDNA Labs, Inc.: In August 2008, Interleukin Genetics announced a marketing, sales and distribution agreement for its proprietary PST genetic risk assessment test for use in the diagnosis of periodontal disease. As compensation, the Company will receive a payment from OralDNA
'/>"/>

SOURCE Interleukin Genetics, Inc.
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6 7

Related biology technology :

1. Interleukin Genetics to Present New Findings on Osteoporosis at the 58th Annual Meeting of the American Society of Human Genetics
2. Interleukin Genetics to Present New Findings at the 11th Cardiovascular Genomics and Atherosclerosis Symposium
3. Interleukin Genetics and Alticor Agree on Expansion of Distribution Channels for Genetic Tests
4. Interleukin Genetics Licenses its PST(R) Genetic Test to OralDNA Labs
5. Interleukin Genetics Announces Conference Call and Webcast to Discuss Second Quarter 2008 Business Results
6. Interleukin Genetics to Present at 2008 BIO International Convention
7. Interleukin Genetics to Present at the 13th International Conference on Periodontal Research
8. Interleukin Genetics Welcomes the Signing of the Genetic Information Nondiscrimination Act (GINA)
9. Interleukin Genetics to Present at Rodman & Renshaw 5th Annual Global Healthcare Conference
10. Interleukin Genetics Announces Conference Call and Webcast to Discuss First Quarter 2008 Business Results
11. Interleukin Genetics Appoints Eliot M. Lurier Chief Financial Officer
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/16/2014)... -- BCC Research reveals in its new ... the global market for stem cells is expected to ... five-year compound annual growth rate (CAGR) of 13.6%. The ... growth projections of $2.2 billion in 2014 to $3.9 ... Unlike other potential applications of bioscience, stem ...
(Date:9/15/2014)... drives classical phase transitionsthink solid, liquid, and ... the temperature drops. If phase transitions occur ... mechanics reigns, subtle fluctuations can dramatically transform ... U.S. Department of Energy,s Brookhaven National Laboratory ... frigid landscape of absolute zero to isolate ...
(Date:9/15/2014)... , Sept. 15, 2014 ... on revolutionizing the treatment of cancer through the ... cells, announced that, together with the Asbestos Disease ... Cancer Institute New South Wales (NSW) Premier,s Award ... four recipients are the hospitals that will be ...
(Date:9/15/2014)... a patient has sepsis, a life-threatening condition in which ... often too fast for antibiotics to help. A new ... a team at Harvard,s Wyss Institute for Biologically Inspired ... , "Even with the best current treatments, sepsis ... 30 percent of the time," said Mike Super, Ph.D., ...
Breaking Biology Technology:Global Market for Stem Cells to Reach $10.6 Billion in 2018; The Americas Growing at 13.9% CAGR 2Global Market for Stem Cells to Reach $10.6 Billion in 2018; The Americas Growing at 13.9% CAGR 3Elusive quantum transformations found near absolute zero 2Elusive quantum transformations found near absolute zero 3EnGeneIC Named a Recipient of the Cancer Institute NSW Premier's Award for Excellence in Translational Cancer Research 2EnGeneIC Named a Recipient of the Cancer Institute NSW Premier's Award for Excellence in Translational Cancer Research 3Blood-cleansing biospleen device developed for sepsis therapy 2Blood-cleansing biospleen device developed for sepsis therapy 3Blood-cleansing biospleen device developed for sepsis therapy 4
... ... , ... Ind. (Vocus) June 17, 2009 –- Pioneer Hi-Bred , a DuPont business, ... to bring additional corn and soybean products to growers in the marketplace. Under these ...
... 17 Campbell Alliance, the leading management consulting firm ... that it has appointed industry veterans Jon W. McGarity ... gentlemen will work directly with John Campbell, CEO of ... advise the firm,s emerging and midsize client companies. ...
... QC, June 17 /PRNewswire-FirstCall/ - BioSyntech, Inc. (TSX: ... regenerative medicine, today announced statistically significant results from ... month follow-up in the BST-CarGel(R) randomized clinical trial. ... quality due to BST-CarGel treatment was found during ...
Cached Biology Technology:Pioneer Hi-Bred and Beck's Hybrids Enter into Research and Distribution Agreements 2Pioneer Hi-Bred and Beck's Hybrids Enter into Research and Distribution Agreements 3Campbell Alliance Adds Industry Veterans Jon W. McGarity and David Lilley as Executive Vice Presidents 2Campbell Alliance Adds Industry Veterans Jon W. McGarity and David Lilley as Executive Vice Presidents 3Campbell Alliance Adds Industry Veterans Jon W. McGarity and David Lilley as Executive Vice Presidents 4BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 2BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 3BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 4BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 5
(Date:9/16/2014)... CRG researchers shed ... Journal of Cell Biology describes how Topo 2 disentangles ... At this very moment thousands of our body,s cells are ... body repairs damaged tissues and regenerates others like skin and ... during which the cell duplicates its genetic material and separates ...
(Date:9/16/2014)... , Sept. 16, 2014  Valencell, Inc., a leader ... as one of 18 "Showcase Companies" representing ... the annual CED Tech Venture Conference on September 16-17 ... Convention Center in Raleigh, North Carolina ... lead a discussion during the "Digital Health Spotlight Sector" ...
(Date:9/15/2014)... and gut microbes influence processes from digestion to disease ... most biodiverse terrestrial ecosystems on the planet, more is ... the tropics. Smithsonian scientists and colleagues working on Panama,s ... a single tree were home to more than 400 ... tree species contained more than 7,000 different kinds. , ...
Breaking Biology News(10 mins):Unraveling cell division 2Unraveling cell division 3Valencell, Inc. Selected as 'Showcase Company' at CED Tech Venture Conference 2014 2Smithsonian scientists discover tropical tree microbiome in Panama 2
... reefs build their structures by both producing and accumulating ... and continued vertical growth capacity of reefs. An international ... carbonate being added by Caribbean coral reefs is now ... in some habitats is as much as 70% lower. ...
... the climate began warming at the end of the last ... to a warmer climate. But how will forests adapt to ... Foundation has awarded a $1.5 million grant to Drs. Stephen ... from the University of Maryland Center for Environmental Science,s Appalachian ...
... technique have determined the precise configuration of humulones, substances ... That might not sound like a big deal ... reported in scientific literature in the last 40 years ... some types of cancer and other maladies. "Now ...
Cached Biology News:New evidence highlights threat to Caribbean coral reef growth 2New evidence highlights threat to Caribbean coral reef growth 3New study will predict how trees will adapt to rapid climate change 2Beer's bitter compounds could help brew new medicines 2
... Knockout System provides optimized reagents and protocols ... bacterial genes by insertion of group II ... of group II introns and utilizes a ... group II intron for specific insertion into ...
... monoclonal antibody raised against a partial recombinant MAK. ... a.a. ~ 457 a.a) partial recombinant protein with ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Biology Products: