Navigation Links
Insmed Announces Financial Results For Second Quarter And Six-months Ended June 30, 2012
Date:8/7/2012

three months ended June 30, 2011. The $0.3 million improvement in the net loss was due to a $1.5 million reduction in operating expenses, which was partially offset by a $1.0 million decline in IPLEX® revenue and a $0.2 million reduction in investment income.

Insmed did not record any revenues for the three months ended June 30, 2012 as compared to $1.0 million in revenues reported for the three months ended June 30, 2011.
The $1.0 million decrease was due to the elimination of IPLEX EAP revenues following the depletion of IPLEX inventory in December 2011.

Research and development expenses decreased to $7.5 million in the three months ended June 30, 2012 from $8.7 million for the three months ended June 30, 2011.
The decrease of $1.2 million in 2012 is primarily attributable to a reduction of $2.9 million in development costs associated with initiating two ARIKACE related clinical trials, as compared to the same period in 2011, when three trials were being planned.  This includes the one-time start-up costs for each of the three trials in 2011, which were not duplicated in 2012.  This reduction was partially offset by an increase of $1.8 million in manufacturing costs associated primarily with initiating the nine-month dog inhalation toxicity study and the build-up of clinical trial drug supply for the ongoing ARIKACE CLEAR-108 and TARGET-NTM clinical studies.

General and administrative expenses of $2.5 million for the three months ended June 30, 2012 were $0.2 million lower than the $2.7 million for the same quarter in 2011 due mainly to a reduction in external finance and legal fees.Investment income for the second quarter of 2012 of $0.3 million was $0.2 million lower than the corresponding period in 2011 due to the lower cash balance available for investment.

Net loss attributable to common stockholders for the six months ended June 30, 2012 was $16.5 million (or $0.67 per common share – basic and diluted),
'/>"/>

SOURCE Insmed Incorporated
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6 7 8 9

Related biology technology :

1. Insmed Secures $20 Million Loan Agreement With Hercules Technology Growth Capital
2. Insmed Incorporated Provides Corporate Update
3. Organogenesis Announces Annual College Scholarship Award Winner
4. Bion Announces Approval of New Canadian Patent
5. PDL BioPharma Announces Second Quarter 2012 Financial Results
6. BioPower Operations Corporation Announces that FTZ Exchange Signs Strategic Alliance with Capacity 360, LLC and Tom Settineri
7. Accuray Announces First CyberKnife System in South America
8. Haemonetics Reports First Quarter Fiscal 2013 Results, Completes Acquisition of Palls Transfusion Medicine Business, Affirms Fiscal 2013 Earnings Guidance, Provides Preliminary Outlook for Fiscal 2014 and Announces Share Repurchase
9. Karyopharm Therapeutics announces the Publication of Two Preclinical Studies on the Activity of Selective Inhibitors of Nuclear Export (SINE) in Acute Myeloblastic Leukemia (AML)
10. AMRI Announces Second Quarter 2012 Results
11. MAP Pharmaceuticals, Inc. Announces Proposed Public Offering of Common Stock
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:1/15/2014)... DTS Language Services, Inc . is ... for Life Science organizations who need document translations. Clients ... of their documents in advance with a selection of nearly ... translations, often a critical factor in clinical and scientific fields, ...
(Date:1/14/2014)... Doylestown, PA (PRWEB) January 14, 2014 Date: ... p.m. , Location: Warrington Country Club, 1360 Almshouse Road, Warrington, ... only national nonprofit organization solely dedicated to finding a cure ... those affected worldwide, will host its annual Crystal Ball on ...
(Date:1/14/2014)... (PRWEB) January 14, 2014 EquitiesIQ, a ... Inc. (OTCQB: ALQA). Alliqua is an emerging biomedical company ... the wound care market. , Free report download: ... with a seasoned management team and Board, which launched ...
(Date:1/14/2014)... Jan. 14, 2014  RXi Pharmaceuticals Corporation (OTCQX: RXII), ... commercializing innovative therapies addressing major unmet medical needs ... the Notice of Allowance from the United States ... RNAi compounds (sd-rxRNA®), for the treatment of fibrosis. ...
Breaking Biology Technology:DTS Improves Efficiency for Life Science Document Translations 2Hepatitis B Foundation to Host Annual Crystal Ball Gala 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 3RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 2RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 3
... CARY, N.C., May 19, 2011 ... its flexible 100% web-based Life Science Study Management ... successfully used globally by Leading European and USA ... eStudy,s on-line study design, management, communication, data collection ...
... CLARA, Calif., May 19, 2011 The 2012 federal ... National Nanotechnology Initiative (NNI), a federal interagency research and ... manipulation of matter at the nanoscale—a measurement of particles ... meter) in size.  While nanoscale materials are found in ...
... Inc., a Massachusetts-based biopharmaceutical company, announced today that it ... Administration on a Special Protocol Assessment (SPA) for a ... agent for patients with newly diagnosed prostate cancer. The ... with definitive results expected by 2015. The randomized study ...
Cached Biology Technology:Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 2Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 3Environmental Training Center Prepares Companies to Handle Nanotechnology Environmental and Human Safety Impacts 2Advantagene Announces SPA Agreement With FDA to Launch Phase 3 Trial for Novel Vaccine Aimed at Preventing Prostate Cancer Recurrence 2
(Date:4/17/2014)... NJ. April 16, 2014. Kessler Foundation has been ... million from the Department of Defense Spinal Cord ... principal investigator for the randomized, double-blinded, controlled, multi-site ... bone and muscle strength after spinal cord injury. ... & Engineering Research at Kessler Foundation. Two additional ...
(Date:4/17/2014)... births, Down syndrome - or trisomy 21 - is ... results from a chromosomal abnormality where cells of affected ... of the human genome). A study conducted by Stylianos ... Medicine and Development at the University of Geneva (UNIGE) ... light on how the extra chromosome 21 upsets the ...
(Date:4/17/2014)... ago, Katia Silvera , a postdoctoral scholar at the ... field trip in a mountainous area in central Panama when ... , Unable to identify it, they contacted German Carnevali, a ... be an unnamed species. So Carnevali recently named it after ... genus name, comprising about 40 species in the world. ...
Breaking Biology News(10 mins):Kessler Foundation awarded Department of Defense grant for spinal cord injury research 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 3Orchid named after UC Riverside researcher 2Orchid named after UC Riverside researcher 3
... fruit flies eat like horses. Hatching inside over-ripe fruit where they ... sends them an offer they cant refuse. To survive, they must ... they avoid food as if it were poison. Only then can ... to lay their own eggs. Now, a team of researchers ...
... migration to EAC ePassport technology, DALLAS, May ... (Nasdaq: ENTU ) will provide its proven ... authenticate sensitive,biometric information stored on machine readable travel ... will be available to nearly 23 million,citizens by ...
... Board: BKYI) today announced plans to release first quarter,2008 financial ... conjunction with the release, BIO-key has scheduled a conference call,which ... 15, 2008 at,9:00 a.m. Eastern Time., What: ... Call ...
Cached Biology News:Fruit fly avoidance mechanism could lead to new ways to control pain in humans 2Entrust, Hewlett Packard Partner to Deploy Taiwanese ePassports, Authenticate Biometric Data 2Entrust, Hewlett Packard Partner to Deploy Taiwanese ePassports, Authenticate Biometric Data 3BIO-key(R) Announces First Quarter 2008 Earnings Release and Conference Call Schedule 2
Mouse monoclonal antibody raised against a full length recombinant CSNK2A2. NCBI Entrez Gene ID = CSNK2A2...
... DNA Visualizer Extraction Kit is manufactured ... causing DNA damage byexposure to UV light. ... gel is often used for DNA-cloning work. ... ethidium bromide and exposure of UV light ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Biology Products: