Navigation Links
Infectious Immunology Market Outlook in BRICS (Brazil, Russia, India, China, South Africa) to 2018
Date:1/23/2013

rket 157

9.18 Tulip Diagnostics (P) Ltd 158

9.18.1 Company Overview 158

9.18.2 Share in the BRICS Infectious Immunology Market 158

9.19 Cellestis Limited 159

9.19.1 Company Overview 159

9.19.2 Share in the BRICS Infectious Immunology Market 159

9.20 Chembio Diagnostics, Inc. 160

9.20.1 Company Overview 160

9.20.2 Share in the BRICS Infectious Immunology Market 160

9.21 Hologic, Inc. 161

9.21.1 Company Overview 161

9.21.2 Share in the BRICS Infectious Immunology Market 161

10 Appendix 162

10.1 Definitions of Markets Covered in the Report 163

10.1.1 Infectious Immunology 163

10.2 Research Methodology 164

10.3 Secondary Research 164

10.4 Primary Research 165

10.5 Models 165

10.6 Forecasts 166

10.7 Expert Panels 166

10.8 GlobalData Consulting 166

10.9 Currency Conversion 167

10.10 Contact Us 167

10.11 Disclaimer 167

List of Tables

Table 1: Infectious Immunology, BRICS, Overall Revenue ($m), USD Constant, 2004-2018 16

Table 2: Infectious Immunology, BRICS, Overall Revenue ($m), USD Constant, Historic, 2004-2011 18

Table 3: Infectious Immunology, BRICS, Overall Revenue ($m), USD Constant, Forecast, 2011-2018 20

Table 4: Infectious Immunology, BRICS, Company share by Revenue ($m), USD Constant, 2010-2011 22

Table 5: Infectious Immunology, Brazil, Overall Revenue ($m), USD Constant, 2004-2018 24

Table 6: Infectious Immunology, Brazil, Overall Revenue ($m), USD Constant, Historic, 2004-2011 26

Table 7: Infectious Immunology, Brazil, Overall Revenue ($m), USD Constant, Forecast, 2011-2018 28

Table 8: Hepatitis Viruses, Brazil, Revenue ($m), USD Constant, Historic, 2004-2011 29

Table 9: Hepatitis Viruses, Brazil, Revenue ($m), USD Constant, Forecast, 2011-2018 30

Table 10: Other Virology, Brazil, Revenue ($m), USD Constant, Histo
'/>"/>

SOURCE Reportlinker
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17

Related biology technology :

1. India In Vitro Diagnostics Market Outlook to 2017- Clinical Chemistry Genetic Testing, Haematology, Histology and Cytology, Immuno Chemistry, Infectious Immunology and Microbiology Culture
2. US Lab Deployed to Boost Mexicos Response to Outbreaks of Infectious Disease
3. Discovered Evolution of Genomic Sequences -- from Ocean Archaea to Brain Cancer -- Leads to New Synthetic Replikin Vaccines for Infectious Diseases and Cancer
4. Soligenix Announces Collaboration with Infectious Disease Research Institute to Develop Thermostabilized Biodefense Vaccines Utilizing Novel Adjuvants
5. Infectious Disease Prevalence and New Strains Appearing Each Year Makes a Watertight Case for Clinical Laboratory Testing, Finds Frost & Sullivan
6. Synthetic Biologics and Intrexon Corporation Enter Worldwide Exclusive Collaboration for Infectious Diseases
7. Frost & Sullivan: Asia Pacific Infectious Disease Diagnostics Market Grows as Economies Boom and Countries Become Image Conscious
8. Synthetic Biologics to Acquire Clinical-Stage C. difficile Infectious Disease Program
9. Sofie Biosciences Is Awarded a US Patent on a Family of Novel PET Probes for Use in Oncology and Immunology
10. Avery-Landsteiner Prize for Immunology Awarded to Alain Fischer of Paris, France, by German Society for Immunology
11. Immunology 2013™ Travel Grants Available from R&D Systems
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/16/2014)... Valley, Arizona (PRWEB) September 16, 2014 ... that develops safe and effective products to treat ... the use of a proprietary SPACE™ Technology Platform ... Officer and President will present at the White ... 2014 at the Hyatt Regency Phoenix. In ...
(Date:9/16/2014)... , Sept. 16, 2014  Ascendis Pharma ... TransCon technology to address significant unmet medical needs, ... Phase 2 pediatric study to evaluate once-weekly TransCon ... or GHD.  The full interim results will be ... GRS and IGF Society, being held October 15-18, ...
(Date:9/16/2014)... According to Jeff Howell, Partner of Nidea ... new development in Downtown Toronto is expanding at a ... 755 storeys of new development last week (including three ... dominating the Toronto skyline for the foreseeable future in ... for new development. , As the Toronto city council ...
(Date:9/15/2014)... GREENBELT, Md. , Sept. 15, 2014 /PRNewswire/ ... a leading innovator of scientific products and services ... government-wide One Acquisition Solution for Integrated Services (OASIS) ... Service (FAS). GST was selected to provide the ... in the Small Business (SB) category in Pool ...
Breaking Biology Technology:Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 2Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 2Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 4ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 2ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 3Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 2Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 3
... HUBBARD, Ohio, Sept. 24 /PRNewswire-Firstcall/ -- NanoLogix, Inc. ... an exhibitor and,participant in the "Energy from Biomass ... David L. Lawrence Convention,Center in Pittsburgh, Pennsylvania September ... NanoLogix booth at the Expo, with,Dana Allen, Bret ...
... Seasoned leader brings added expertise to Shire ... England, Sept. 24, Shire plc (LSE: SHP, ... company, announced today that Sylvie,Gregoire has been ... (HGT),business, effective immediately. Sylvie brings more than ...
... BioCryst,Pharmaceuticals, Inc. (Nasdaq: BCRX ) today ... Life Sciences Conference in New York. A live ... 2007 at 2:00 p.m. Eastern,Time may be accessed ... will be archived for seven days. (Logo: ...
Cached Biology Technology:NanoLogix Inc. to Present at EBW Expo & Conference 2007 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 3Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 4BioCryst to Present at UBS 2007 Global Life Sciences Conference 2BioCryst to Present at UBS 2007 Global Life Sciences Conference 3
(Date:9/16/2014)... to make ethical choices such as buying clothing not ... fair-trade coffee, and bringing their own bags when they ... Journal of Consumer Research , ethical consumption is ... emotions about unethical practices into action. , "Advocates of ... and human costs of the products they choose, but ...
(Date:9/16/2014)... practically all vital functions in an organism. For ... particular substances and control immune system responses. Researchers ... function independently of each other, but instead form ... networks, you find many similarities with online social ... of Plant Systems Biology. "Some proteins are good ...
(Date:9/16/2014)... , Sept. 16, 2014  Cross Match Technologies, ... solutions, announced today the launch of its Verifier ... the identity of an individual using their secure ... Sentry rapidly reads credential documents with embedded biometric ... matching the biometric to a live scan of ...
Breaking Biology News(10 mins):Why are consumers willing to spend more money on ethical products? 2Good networkers make prime targets 2Cross Match Launches New Identity Management Handheld Solution 2
... Children's Hospital of Philadelphia leads a multi-center $6.7 million ... of Mental Health (NIMH) to explore a novel approach ... studies and clinical trials in adult patients, the new ... human immunodeficiency virus: sites on immune cells known as ...
... found Envisat's MERIS sensor can detect coral bleaching ... could potentially monitor impacted coral reefs worldwide on ... symbiotic algae living in symbiosis with living coral ... expelled. The whitening coral may die with subsequent ...
... what happens in cells is the work of machines that ... human and other genomes, researchers now have a nearly complete ... manual telling where all the pieces go. A new study ... to answer this question for some of the smallest and ...
Cached Biology News:Federal grant funds research on novel HIV therapy 2Federal grant funds research on novel HIV therapy 3Health of coral reefs detected from orbit 2Many needles, many haystacks 2
... Knockout System provides optimized reagents and protocols ... bacterial genes by insertion of group II ... of group II introns and utilizes a ... group II intron for specific insertion into ...
... monoclonal antibody raised against a partial recombinant MAK. ... a.a. ~ 457 a.a) partial recombinant protein with ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Biology Products: