Navigation Links
Inaugural Pharma Exchange Conference Produced by Informex to Draw Together Milwaukee, Wisconsin Chemical Industry
Date:9/30/2010

dge Major, Evonik Degussa, Fontarome, Rondaxe, Metropolitan Milwaukee Association of Commerce, SAFC and the University of Wisconsin Milwaukee Research Fund.

"Milwaukee was a natural choice for the location of the first Pharma Exchange Conference as chemical manufacturing is integral to economic development in Wisconsin," commented Jennifer Jessup, Global Brand Director, Informex. Chemistry companies in Wisconsin directly employ over 15,000 people and indirectly contribute nearly 43,000 jobs to the economy.* Jessup further states, "The Midwest highly values the pharmaceutical industry and we are delighted to be able to provide a forum for local influencers to gather to enhance the region and their individual businesses. We hope that once this inaugural event takes place, it will be the catalyst for further networking by and within the region."

At the event, there will be a feature presentation during lunch about investment strategies entitled: 'Capturing Value: What's Needed to Support Growth from Dollars to Counsel' with representatives from private equity and venture capital firms including: Trevor D'Souza, Mason Wells Venture Fund, Managing Director and John Beagle, Grace Matthews, Co-Founder.

To find out more information please visit www.informex.com/web/pharma-exchange or to register for this conference, please visit: http://www.regonline.com/Register/Checkin.aspx?EventID=897566.

*American Chemistry Council: Snapshot of the Chemical Industry in Wisconsin (January 10, 2010)

UBM Live is a wholly owned subsidiary of United Business Media plc (LSE: UBM) a leading provider of business information services to the maritime, travel, fashion, technology, healthcare, media, and property industries. UBM offers services in trade shows, online, news distribution, and publishing to customers acr
'/>"/>

SOURCE Informex
Copyright©2010 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Inaugural Meeting of Virtual Fertilizer Research Center Board of Advisors Held in Washington, D.C.
2. The Tile Doctor Launches Inaugural Product Line
3. NTU professor bags inaugural award honoring women in science
4. Excalibur International Marine (49% Owned by EFT BioTech Holdings) Completes Inaugural Passenger Crossing of Taiwan Strait
5. EFT BioTech Holdings, Inc.s Sea Vessel Completes Inaugural Passenger Voyage Across the Taiwan Strait
6. BIOCOMs Inaugural CALAsia Forum Bridging the Pacific
7. Aegis Analytical Corp. Showcases Discoverant at Inaugural Venture Capital in the Rockies Fall
8. Preliminary Report of American Biotech Labs HIV Study Featured in Inaugural Issue of Journal of the Science of Healing Outcomes
9. Inaugural Kavli Prize ceremony and symposia: Sept. 8-11 (Oslo, Norway)
10. Access Pharmaceuticals Furthers Progress on Its Cobalamin-mediated Targeted Drug Delivery Platform for siRNA
11. Syndax Pharmaceuticals to Present at BIO Investor Forum
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:1/15/2014)... DTS Language Services, Inc . is ... for Life Science organizations who need document translations. Clients ... of their documents in advance with a selection of nearly ... translations, often a critical factor in clinical and scientific fields, ...
(Date:1/14/2014)... Doylestown, PA (PRWEB) January 14, 2014 Date: ... p.m. , Location: Warrington Country Club, 1360 Almshouse Road, Warrington, ... only national nonprofit organization solely dedicated to finding a cure ... those affected worldwide, will host its annual Crystal Ball on ...
(Date:1/14/2014)... (PRWEB) January 14, 2014 EquitiesIQ, a ... Inc. (OTCQB: ALQA). Alliqua is an emerging biomedical company ... the wound care market. , Free report download: ... with a seasoned management team and Board, which launched ...
(Date:1/14/2014)... Jan. 14, 2014  RXi Pharmaceuticals Corporation (OTCQX: RXII), ... commercializing innovative therapies addressing major unmet medical needs ... the Notice of Allowance from the United States ... RNAi compounds (sd-rxRNA®), for the treatment of fibrosis. ...
Breaking Biology Technology:DTS Improves Efficiency for Life Science Document Translations 2Hepatitis B Foundation to Host Annual Crystal Ball Gala 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 3RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 2RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 3
... CARY, N.C., May 19, 2011 ... its flexible 100% web-based Life Science Study Management ... successfully used globally by Leading European and USA ... eStudy,s on-line study design, management, communication, data collection ...
... CLARA, Calif., May 19, 2011 The 2012 federal ... National Nanotechnology Initiative (NNI), a federal interagency research and ... manipulation of matter at the nanoscale—a measurement of particles ... meter) in size.  While nanoscale materials are found in ...
... Inc., a Massachusetts-based biopharmaceutical company, announced today that it ... Administration on a Special Protocol Assessment (SPA) for a ... agent for patients with newly diagnosed prostate cancer. The ... with definitive results expected by 2015. The randomized study ...
Cached Biology Technology:Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 2Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 3Environmental Training Center Prepares Companies to Handle Nanotechnology Environmental and Human Safety Impacts 2Advantagene Announces SPA Agreement With FDA to Launch Phase 3 Trial for Novel Vaccine Aimed at Preventing Prostate Cancer Recurrence 2
(Date:4/17/2014)... NJ. April 16, 2014. Kessler Foundation has been ... million from the Department of Defense Spinal Cord ... principal investigator for the randomized, double-blinded, controlled, multi-site ... bone and muscle strength after spinal cord injury. ... & Engineering Research at Kessler Foundation. Two additional ...
(Date:4/17/2014)... births, Down syndrome - or trisomy 21 - is ... results from a chromosomal abnormality where cells of affected ... of the human genome). A study conducted by Stylianos ... Medicine and Development at the University of Geneva (UNIGE) ... light on how the extra chromosome 21 upsets the ...
(Date:4/17/2014)... ago, Katia Silvera , a postdoctoral scholar at the ... field trip in a mountainous area in central Panama when ... , Unable to identify it, they contacted German Carnevali, a ... be an unnamed species. So Carnevali recently named it after ... genus name, comprising about 40 species in the world. ...
Breaking Biology News(10 mins):Kessler Foundation awarded Department of Defense grant for spinal cord injury research 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 3Orchid named after UC Riverside researcher 2Orchid named after UC Riverside researcher 3
... fruit flies eat like horses. Hatching inside over-ripe fruit where they ... sends them an offer they cant refuse. To survive, they must ... they avoid food as if it were poison. Only then can ... to lay their own eggs. Now, a team of researchers ...
... migration to EAC ePassport technology, DALLAS, May ... (Nasdaq: ENTU ) will provide its proven ... authenticate sensitive,biometric information stored on machine readable travel ... will be available to nearly 23 million,citizens by ...
... Board: BKYI) today announced plans to release first quarter,2008 financial ... conjunction with the release, BIO-key has scheduled a conference call,which ... 15, 2008 at,9:00 a.m. Eastern Time., What: ... Call ...
Cached Biology News:Fruit fly avoidance mechanism could lead to new ways to control pain in humans 2Entrust, Hewlett Packard Partner to Deploy Taiwanese ePassports, Authenticate Biometric Data 2Entrust, Hewlett Packard Partner to Deploy Taiwanese ePassports, Authenticate Biometric Data 3BIO-key(R) Announces First Quarter 2008 Earnings Release and Conference Call Schedule 2
Mouse monoclonal antibody raised against a full length recombinant CSNK2A2. NCBI Entrez Gene ID = CSNK2A2...
... DNA Visualizer Extraction Kit is manufactured ... causing DNA damage byexposure to UV light. ... gel is often used for DNA-cloning work. ... ethidium bromide and exposure of UV light ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Biology Products: