Navigation Links
In Vitro Diagnostics (IVD) - Emerging Countries (Brazil, Russia, India, China) Opportunity Assessment, Competitive Landscape and Market Forecasts to 2018
Date:7/24/2012

br/>Figure 107: Genetic Testing Market, Russia, Company Share (%), 2011 137
Figure 108: In Vitro Diagnostics Market, China, Competitive Assessment, 2011 140
Figure 109: In Vitro Diagnostics Market, India, Competitive Assessment, 2011 141
Figure 110: In Vitro Diagnostics Market, Brazil, Competitive Assessment, 2011 141
Figure 111: In Vitro Diagnostics Market, Russia, Competitive Assessment, 2011 142
Figure 112: Siemens Healthcare, Internal Factors Evaluation 144
Figure 113: F. Hoffmann-La Roche Ltd., Internal Factors Evaluation 146
Figure 114: Abbott Laboratories, Internal Factors Evaluation 148
Figure 115: Sysmex Corporation, Internal Factors Evaluation 150
Figure 116: Transasia Bio-Medicals Ltd., Internal Factors Evaluation 152
Figure 117: Beckman Coulter, Inc., Internal Factors Evaluation 154

Companies mentioned 
Siemens Healthcare
F. Hoffmann-La Roche Ltd.
Abbott Laboratories
Sysmex Corporation
Transasia Bio-Medicals Ltd.
Beckman Coulter, Inc.

To order this report:
In Vitro Diagnostic Industry: In Vitro Diagnostics (IVD) - Emerging Countries (Brazil, Russia, India, China) Opportunity Assessment, Competitive Landscape and Market Forecasts to 2018 

More Market Research Report 
Check our Industry Analysis and Insights 

Nicolas Bombourg
Reportlinker
Email: nicola
'/>"/>

SOURCE Reportlinker
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

Related biology technology :

1. Auxogyn And Reproductive Medicine Associates of New Jersey Partner To Advance in vitro fertilization Research
2. MultiCell Technologies Announces Positive Preclinical Results for MCT-465 and MCT-485 in Primary Liver Cancer In Vitro Models
3. India In Vitro Diagnostics Market Outlook to 2017- Clinical Chemistry Genetic Testing, Haematology, Histology and Cytology, Immuno Chemistry, Infectious Immunology and Microbiology Culture
4. Pittsburgh Based ParentPlus Enters Collaboration with Vitrolife
5. Frost & Sullivan Presents 2012 Clinical Diagnostics Company of the Year Award to GenPath Diagnostics of BioReference Laboratories, Inc.
6. Comprehensive Resource for Food Safety Diagnostics – Romer Labs Launches New Website
7. NextGen introduces its first generation of animal biomarker products for development of brain disorder diagnostics
8. QuantRx® Biomedical Provides Corporate Update: Focused on Diagnostics and Feminine Hygiene Segments
9. Exosome Diagnostics Presents Data at American Urology Association Demonstrating Potential Utility of Urine Exosomes to Non-invasively Detect and Manage Prostate Cancer
10. Ariosa Diagnostics Announces Publication of Study on Influential Factors Affecting Fetal DNA Concentration in Blood of Pregnant Women
11. Ariosa Diagnostics Announces Nationwide Launch of the Harmony™ Prenatal Test Through LabCorp
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/26/2014)... (PRWEB) November 25, 2014 Miles Holder, ... joined the Graphel Carbon Products team as Sales/Marketing Manager. ... marketing, and customer service for the graphite industry. , ... to our team,” stated Dave Trinkley, VP of Market ... wide range of experience in the graphite industry, along ...
(Date:11/26/2014)... 2014 Theravalues Corporation est fier d,annoncer ... européen au salon Hi Europe 2014 (du 2 ... Curcumine la plus biodisponible actuellement sur ... à des ingrédients approuvés par les règlements européens. ... présent dans la racine de curcuma ( Curcuma ...
(Date:11/24/2014)... Nov. 24, 2014  IGI Laboratories, Inc. (NYSE MKT: ... specialty generic pharmaceutical company, today announced it has submitted ... U.S. Food and Drug Administration (FDA), which brings the ... seven, with eighteen submissions now pending at the FDA. ... CEO of the Company, commented, "Our team here at ...
(Date:11/24/2014)... , November 24, 2014   ... online on ScienceDirect   Elsevier , a ... services, is pleased to announce the launch of the latest ... Current Opinion in Food Science . ... will provide specialists with a new platform to keep up-to-date ...
Breaking Biology Technology:Miles Holder Joins Graphel Corporation as Sales/Marketing Manager 2La curcumine présentant la plus haute biodisponibilité bientôt en vente en Europe 2La curcumine présentant la plus haute biodisponibilité bientôt en vente en Europe 3IGI Laboratories, Inc. Announces ANDA Submission 2Elsevier Announces Launch of New Journal: Current Opinion in Food Science 2Elsevier Announces Launch of New Journal: Current Opinion in Food Science 3
... Aug. 25 Reportlinker.com announces that a new ... Protein Kinase Therapeutics in Oncology ... http://www.reportlinker.com/p0284973/Protein-Kinase-Therapeutics-in-Oncology---Where-to-Commercialize.html This report comprises defined ... protein kinase drugs (990 projects) within the portfolio ...
... KONG, Aug. 25 bioserie is first to market ... give earth-conscious Apple device owners the protection they demand ... production. bioserie,s unique use of the latest in bioplastics ... and the prevention of environmental toxic pollution once the ...
... meet three goals in the production of biofuels ... production and ecological sustainability. Syracuse University,s Radhakrishna Sureshkumar, ... in the L.C. Smith College of Engineering and ... Satvik Wani have uncovered a process that is ...
Cached Biology Technology:Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 2Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 3Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 4Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 5Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 6Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 7Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 8Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 9Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 10Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 11Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 12Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 13Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 14Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 15Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 16Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 17Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 18Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 19Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 20bioserie Introduces the World's First 'Made of Plants' iPhone 4 Cover 2SU research team uses nanobiotechnology-manipulated light particles to accelerate algae growth 2
(Date:11/18/2014)... --  News Highlights: , ... Partners Data Lake, an agile data and analytics ... allow researcher and clinicians to explore and develop ... of patients , The Partners Data Lake ... Partners system, breaking down physical barriers for collaboration ...
(Date:11/15/2014)... -- While we may still be a few years away from ... to gain instant access to all that ailed his patients, ... tablets for monitoring and measuring our health are cropping up ... a tad Orwellian to some, but a new survey suggests ... opportunities into their healthcare regime. These are some ...
(Date:11/10/2014)... appearing on U.S. store shelves in early 2010, and ... The small packets can be tossed into a washing ... or powder. The convenience, though, has come with risks ... at Nationwide Children,s Hospital found that from 2012 through ... children younger than 6 years of age swallowing, inhaling, ...
Breaking Biology News(10 mins):Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 2Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 3Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 4Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 5Americans May Be Ready for a Brave New World of Healthcare 2Americans May Be Ready for a Brave New World of Healthcare 3Americans May Be Ready for a Brave New World of Healthcare 4Study finds laundry detergent pods, serious poisoning risk for children 2
... For the first time, researchers have confirmed an association ... and abnormalities on brain MRI, according to a new ... The new study raises the possibility that a toxic ... body long after administration. Brain MRI exams ...
... Peterhans, a Roosevelt University professor and adjunct curator at ... mammals in Africa, has announced the discovery of four ... of the Democratic Republic of Congo. , The mammals ... led by the Wildlife Conservation Society (WCS) and in ...
... of millions of Americans, there,s no such thing as the ... hear a constant ringing, buzzing, hissing, humming or other noise ... be debilitating and life-altering. Now, University of Michigan ... what is going on inside their unquiet brains. The ...
Cached Biology News:Contrast agent linked with brain abnormalities on MRI 2Chicago scientist involved in discovery of 4 new mammal species in Democratic Republic of Congo 2U-M tinnitus discovery opens door to possible new treatment avenues 2U-M tinnitus discovery opens door to possible new treatment avenues 3
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Mouse monoclonal antibody raised against a partial recombinant QARS. NCBI Entrez Gene ID = QARS...
Mouse monoclonal antibody raised against a partial recombinant QPCT. NCBI Entrez Gene ID = QPCT...
Biology Products: