Navigation Links
Human Pheromone Sciences Announces Third Quarter Results
Date:11/13/2008

Increase in revenue with reduction in loss for the quarter

SAN JOSE, Calif., Nov. 13 /PRNewswire-FirstCall/ -- Human Pheromone Sciences, Inc. (OTC Bulletin Board: EROX) ("HPS" or "the Company") today announced results for the third quarter and nine months ended September 30, 2008. For the three month period ending September 30, 2008, net revenues of $262,000 represented a 10% increase from the revenues of $239,000 in the prior year period, and resulted in a net loss of $30,000 ($.01 per share) as compared with a net loss of $93,000 ($.02 per share) for the same period of 2007. For the nine month period ending September 30, 2008, net revenues of $764,000 were 15% lower than the previous year's $902,000, resulting in a net loss of $181,000 ($0.04 per share) as compared with a net loss of $54,000 ($0.01 per share) in the first nine months of 2007. At September 30, 2008, the Company reflected a cash balance of $1,082,000 compared with $1,437,000 at December 31, 2007, a $355,000 reduction for the nine months of the current year as compared to a decline of $390,000 during the nine months ending September 30, 2007. There was no bank indebtedness at either date.

A spokesperson indicated "the Company was pleased that its cash utilization was only $355,000 for the first nine months of the year, and that net current liquidity (cash, accounts receivable and inventory, less current liabilities excluding current portion of deferred revenue) decreased only $433,000 for the same nine month period. This lower than expected asset utilization was a result of revenues generated under new licensing agreements, and a concerted effort to only invest in programs that are designed to generate additional future revenues."

"However, we still recognize that the marketing plans of our licensees can create unpredicted volatility of our quarterly performance, and this is not an acceptable posture for the Company in the long-term. We will still continue to nurture
'/>"/>

SOURCE Human Pheromone Sciences, Inc.
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2 3 4

Related biology technology :

1. Transdermal Diclofenac enters Phase 1 Clinical Trial in Humans
2. Interleukin Genetics to Present New Findings on Osteoporosis at the 58th Annual Meeting of the American Society of Human Genetics
3. Human Genome Sciences Invites Investors to Listen to Webcast of Presentation at Deutsche Bank Conference
4. Human Genome Sciences Announces Third Quarter 2008 Financial Results and Key Developments
5. Data to Be Presented at 58th Annual Meeting of The American Society of Human Genetics
6. Ambrx to Present Phase I/II Clinical Data for Optimized, Long Acting Human Growth Hormone Analogue
7. Complete Genomics Chooses Isilon IQ to Power Worlds First Complete Human Genome Sequencing Service
8. Human Genome Sciences to Sponsor Conference Call to Discuss Third Quarter 2008 Financial Results
9. Human Pheromone Sciences, Inc. - Shareholder Update
10. The human brain minimizes energy expenditure and integrates gravity in to the action plan
11. EntreMeds ENMD-2076 Demonstrates Tumor Regression in Human Colon Cancer Model
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:1/22/2015)... 2015 Protocol Networks brings independent technology ... of brand-neutral, independent consultants, Protocol Networks has recently announced ... over the years, his company has attracted several clients ... Plainfield, as well as others. With the success of ...
(Date:1/22/2015)... Pipette.com has added the Eppendorf ... portfolio of Eppendorf products. , The Eppendorf Centrifuge 5424/5424 ... 5424/5424 R and receive the following:, , ... or Eppendorf Reference 2 ,     3 Free ...
(Date:1/22/2015)... Madison, WI (PRWEB) January 22, 2015 Dr. ... at the 12th annual Scripps Natural Supplements Pre-Conference seminar on ... Supplements Conference is an annual continuing education conference for health ... 15th and included the topic of probiotics in health. Dr. ...
(Date:1/22/2015)... January 22, 2015 Selexis SA, a ... Research Cell Banks (RCBs) used for drug discovery to ... Banks will include Next-Generation Sequencing (NGS) data ... de-risks biologic manufacturing by ensuring the integrity of the ...
Breaking Biology Technology:Protocol Networks Brings Independent Technology Consulting to the Constitution State 2Eppendorf Announces Promotional Bundle Which Includes: Eppendorf Centrifuge 5424, 3-Pack of Pipettes, and Tips - Available Now at Pipette.com 2Selexis Generated Research Cell Banks Now Fully Sequenced Using Next-Generation Sequencing 2
... AUSTIN, Texas and TORONTO, Oct. 3 Two ... to integrate vibration,therapy into the stem cell harvesting ... company based in Austin,Texas, has signed an exclusive ... of Toronto, Ontario. The partnership,between the two companies ...
... ),AMDL, Inc. (Amex: ADL ), a leading vertically ... US, today announced that the,Company will present at the ... Tuesday, October 7, 2008 at 10:30 a.m. ET. AMDL,s ... Hotel in the Morosco Room., The Maxim Group ...
... Stock Exchange Symbol: MS, EDMONTON, Oct. 3 ... developer in the treatment of multiple sclerosis (MS), ... (DSMB) for the,Company,s U.S. pivotal phase III MAESTRO-03 ... MS has completed a safety analysis,and recommended that ...
Cached Biology Technology:New Partnership Integrates Vibration Therapy Into Stem Cell Procedures 2New Partnership Integrates Vibration Therapy Into Stem Cell Procedures 3AMDL, Inc. to Present at Maxim Group Growth Conference October 7, 2008 2AMDL, Inc. to Present at Maxim Group Growth Conference October 7, 2008 3BioMS Medical's phase III U.S. multiple sclerosis trial receives positive safety review from Data Safety Monitoring Board 2
(Date:12/24/2014)... its launch in December 2014, the 1U™ app ... trying to remember their usernames and passwords through replacing the ... To assist people who have struggled to remember usernames and ... and focuses on redefining identity, announced today that it is ...
(Date:12/22/2014)... DUBLIN , Dec. 22, 2014 Research and ... the addition of the "The Global Watermarking ... http://photos.prnewswire.com/prnh/20130307/600769 ... global digital media watermarking and fingerprinting markets. Watermarking ...
(Date:12/19/2014)... , Dec. 18, 2014 Research and Markets ... "iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & ... http://photos.prnewswire.com/prnh/20130307/600769 ... introduced the fingerprint reading feature with the iPhone 5S. ...
Breaking Biology News(10 mins):1U Offers Best Solution to the Username / Password Dilemma: For FREE! 21U Offers Best Solution to the Username / Password Dilemma: For FREE! 3The Global Watermarking and Fingerprinting Markets 2iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & Sapphire - Technology Report 2
... in a group of heat-loving bacteria by researchers at ... light a fire under next-generation biofuel production. Scientists ... to break down complex plant material such as switchgrass ... make biofuels. Conventional processes involve the addition of commercially ...
... faded since the end of the Cold War, existing ... devastating global impacts. Researchers at the University of ... effects of a hypothetical nuclear war between India and ... in distant countries. The work, by Mutlu Ozdogan ...
... in our bodies. This process is driven by microtubule filaments ... so-called motor proteins in the cytosol can control their dynamics. ... of cell division. It is composed in large part of ... size, shape and mobility of a cell. In a new ...
Cached Biology News:BESC researchers tap into genetic reservoir of heat-loving bacteria 2War-related climate change would reduce substantially reduce crop yields 2
... for high-yield protein expression ,The ... a high-yielding clone of Sf9 cells. Pre-adapted ... Cell Medium, these cells are recommended for ... baculovirus infection or transfection of appropriate vectors. ...
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Mouse monoclonal antibody raised against a partial recombinant QARS. NCBI Entrez Gene ID = QARS...
Biology Products: