Navigation Links
Helix BioPharma announces Q1 2008 financial results
Date:12/17/2007

Product revenues totaled $754,000 in the first quarter of fiscal 2008 and represent 85.2% of total revenues. When compared to the first quarter of fiscal 2007, product revenues increased by $58,000 or 8.3% and are primarily driven by Klean-Prep(TM) product sales.

License fees and royalty revenue

License fees and royalties totaled $131,000 in the first quarter of fiscal 2008 and represent 14.8% of revenues. When compared to the first quarter of fiscal 2007, license fees and royalties were higher by $1,000 or 1.0%. The license fees and royalties in the first quarter of fiscal 2008 and 2007 were comprised solely of royalties related to sales of Klean-Prep(TM) outside of Canada.

Research and development contract revenue

The Company had no research and development contract revenue in both the first quarters of fiscal 2008 and 2007.

Cost of sales and margins

Cost of sales totaled $313,000 in the first quarter of fiscal 2008 (2007 - $290,000) with margins remaining relatively flat. Margins, on a percentage basis, in the first quarter of fiscal 2008 were 58.5% (2007 - 58.3%).

Research & development

Research and development costs in the first quarter of fiscal 2007 totaled $782,000 (2007 - $871,000) for a decrease of $89,000. Lower research and development costs in the first quarter of fiscal 2008 mainly reflect timing of expenditures associated with the Company's L-DOS47 program.

Research and development expenditures related to Topical Interferon Alpha-2b remained relatively flat, with expenditures from the late stage phase II German study during the first quarter of fiscal 2007 being offset by expenditures in the first quarter of fiscal 2008 relating to patient enrollment in the phase II trial in Sweden along with costs associated with patent filings and consulting services.

The Company expects to increase its R&D spending through the remainder of fiscal 2008, as its Topical Interferon Alpha-2b an
'/>"/>

SOURCE Helix BioPharma Corp.
Copyright©2007 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6 7 8 9 10 11

Related biology technology :

1. Helix Biopharma announces addition of University of Arizona professor Kenneth Hatch as new medical advisor
2. Helix BioPharma Chairman resigns
3. Helix BioPharma Corp. announces fiscal 2007 results
4. Helix BioPharma Corp. announces management changes
5. Helix BioPharma announces $16.9 million private placement of common shares
6. China Biopharmaceuticals Holdings Announces Second Quarter 2007 Financial Results
7. XTL Biopharmaceuticals Announces Financial Results for the Six Months Ended June 30, 2007
8. PDL BioPharma Announces Internal CEO Investigation Found No Credible Evidence of Improper Personal Conduct or Breach of Fiduciary Duty
9. Nabi Biopharmaceuticals to Present at Upcoming Industry Conferences
10. PDL BioPharma Announces Significant Strategic and Portfolio Changes to Focus on Antibody Discovery and Development
11. XTL Biopharmaceuticals Announces Presentation of Novel Pre-Clinical Inhibitors of Hepatitis C at an Upcoming International Scientific Conference
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/19/2014)... San Diego, CA (PRWEB) December 18, 2014 ... announces a limited time special on Sartorius Biohit ... 1 Free on mLINE pipettes, Picus Electronic Pipette Trade-in ... recommended by Health and Safety officers around the world. ... repetitive manual pipetting. Other features include:, , ...
(Date:12/19/2014)... 18, 2014   ISN has released its ... Indicators publication series. With data aggregated from ... in 2013 within its online contractor management platform, ISNetworld, ... performance indicator (KPI) statistics. The ... publication is available in two industry specific volumes: ...
(Date:12/17/2014)... Based on the revenues gained ... market is dominated by four major players contributing ... These players include GE Healthcare (U.K.), Siemens AG ... , Full Report Copy at http://www.marketsandmarkets.com/Market-Reports/surgical-imaging-market-210534462.html ... be attributed to its strong product portfolio, which ...
(Date:12/17/2014)... BASKING RIDGE, N.J. (PRWEB) December 17, 2014 ... Ipsen (Euronext: IPN; ADR: IPSEY), ... 120 mg (referred to as Somatuline®) was approved ... for the treatment of gastroenteropancreatic neuroendocrine tumors (GEP-NETs) ... differentiated, locally advanced or metastatic disease to improve ...
Breaking Biology Technology:Major Pipette Distributor Pipette.com Announces Sartorius Year End Specials 2ISN Releases Third Edition of US Contractor Health & Safety Performance Indicators Publication Series 2ISN Releases Third Edition of US Contractor Health & Safety Performance Indicators Publication Series 3Global Refurbished Surgical Imaging Market by Product & Application is Estimated to Reach $1.25 Billion by 2019 - New Research Report by MarketsandMarkets 2Global Refurbished Surgical Imaging Market by Product & Application is Estimated to Reach $1.25 Billion by 2019 - New Research Report by MarketsandMarkets 3Global Refurbished Surgical Imaging Market by Product & Application is Estimated to Reach $1.25 Billion by 2019 - New Research Report by MarketsandMarkets 4Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 2Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 3Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 4Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 5Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 6Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 7Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 8
... 2011 Verenium Corporation (Nasdaq: VRNM ), ... industrial enzyme solutions, today announced that James Levine, Executive ... the upcoming Piper Jaffray Sixth Annual Clean Technology & ... 3:00 p.m. EST on Wednesday, January 12, 2011 and ...
... , WEST LAFAYETTE, Ind. - Researchers are creating a ... natural photosynthetic systems in plants by using carbon nanotubes ... and reducing cost. "We,ve created artificial photosystems using ... to electrical power," said Jong Hyun Choi, an assistant ...
... and BUDAPEST, Hungary, Jan. 4, 2011 The IP ... property research and analysis solutions, and ChemAxon, the leader ... announced a strategic partnership whereby Thomson Reuters is providing ... patent data to users of ChemAxon,s JChem chemical software ...
Cached Biology Technology:Verenium to Present at Piper Jaffray Sixth Annual Clean Technology & Renewables Conference 2Verenium to Present at Piper Jaffray Sixth Annual Clean Technology & Renewables Conference 3New solar cell self-repairs like natural plant systems 2Thomson Reuters and ChemAxon Partner to Help Speed Drug Discovery for Life Science Researchers 2Thomson Reuters and ChemAxon Partner to Help Speed Drug Discovery for Life Science Researchers 3
(Date:12/11/2014)... , Dec. 09, 2014 Research and Markets ... ( http://www.researchandmarkets.com/research/9ql3kr/biometrics_market ) has announced ... India 2015-2019" report to their offering. ... market is the adoption of multimodal biometric systems. ... of an individual for verification and identification purposes. ...
(Date:12/10/2014)... 2014  Wake Forest Baptist Medical Center today announced plans ... of Medicine. Funding for this $50 million capital project ... be publicly launched next summer. The ... 60 series R.J. Reynolds Tobacco Company complex, adjacent to ... immediately with plans to be ready to welcome medical ...
(Date:12/5/2014)... -- Tute Genomics, a leader in cloud-based solutions for genome ... led by UK-based Eurovestech. Peak Ventures and a number ... "We are at a pivotal time in ... seeks new approaches for the diagnosis, treatment and prevention ... and CEO of Tute Genomics. "One of the main ...
Breaking Biology News(10 mins):Biometrics Market in India 2015-2019: Key Vendors are 3M Cogent, NEC, Safran and Suprema 2Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 2Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 3Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... a soil science professor at the University of Guam, has ... use in shielding the reefs in Pago Bay from the ... major health hazards facing Guam,s reefs is soil erosion resulting ... up a reef system. "Vetiver,s ability to tolerate high stress ...
... fog, tennis shoes, chocolate mousse, and proteins have something in ... of research that explains the behavior of a wide variety ... and a number of biological materials. In the ... made of (Springer), Roberto Piazza, professor of condensed matter physics, ...
... in their personal and professional lives, University of ... gain greater control over their thoughts with real-time ... first investigation of how real-time functional Magnetic Resonance ... for higher-order thoughts, including introspection, affects our ability ...
Cached Biology News:Bioengineering with vetiver grass on Guam 2Soft matter -- the stuff that dreams are made of 2People control thoughts better when they see their brain activity: UBC study 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: