Navigation Links
HIPAA 5010 Ready: DST Health Solutions Launches Upgrades of Amisys Advance, PowerMHS, PowerMHC and PowerSTEPP
Date:11/8/2010

BIRMINGHAM, Ala., Nov. 8, 2010 /PRNewswire/ -- DST Health Solutions, LLC, today launched new versions of all four of its core claims administration platforms—Amisys Advance, PowerMHC, PowerMHS and PowerSTEPP. The platforms now support Version 5010, as mandated by the Centers for Medicare & Medicaid Services (CMS). This change—from Version 4010/4010A to Version 5010 of the electronic healthcare transaction standard—will be effective Jan. 1, 2012, as designated by CMS.

These upgrades are a significant part of DST Health Solutions' 5-I Compliance Accelerator Program, designed to help health plans successfully prepare major business systems for compliance with upcoming federal regulations. Within two years, CMS will require healthcare organizations to begin using the new 5010 standards for electronic transactions and within three years upgrade from ICD-9 to ICD-10, a new diagnostic and procedure code set. This transition has been called "healthcare's Y2K."

"Medical Card System, Inc. (MCS) has been tracking these regulatory changes for some time now, and it was clear that we required professional advice," said Ivars Blums, chief information officer of MCS, a Puerto Rico-based health plan and DST Health Solutions client. "DST Health Solutions' consultants have enabled my IT staff to analyze and prepare our PowerMHS environment for a successful transition to 5010 and ICD-10. We know that PowerMHS is fully capable of supporting our goal: to turn these regulations into opportunities to move forward and improve administrative efficiency and quality of care."

The majority of DST Health Solutions' clients are participating in its 5-I Compliance Accelerator Program. Participating clients include health plans utilizing all four of the company's core claims platforms. The program includes assessment services, migration support packages, business impact consulting, readiness roadmaps, transaction maps and supplemental resources to suppo
'/>"/>

SOURCE DST Health Solutions, LLC
Copyright©2010 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Monterey Spine and Joint Deploys WebLOQ ePrivacy Solution for HIPAA Compliant Health Information Exchange
2. Health Robotics Continues Worldwide Consolidation by Entering the Norwegian Market With Beckman Automation
3. Hikma Expands its Global Injectables Business Through the Acquisition of Baxter Healthcare Corporations Multi-Source Injectables Business
4. Midwest Health Care Startups Raise $572 Million Through Q3 2010
5. Beckman Coulter to Present at the Oppenheimer 21st Annual Healthcare Conference
6. Ardea Biosciences to Present at the Oppenheimer 21st Annual Healthcare Conference
7. Regado Biosciences to Present at the Oppenheimer 21st Annual Healthcare Conference in New York City
8. Genomic Health to Announce Third Quarter 2010 Financial Results and Host Conference Call on Monday, November 8, 2010
9. Optimer Pharmaceuticals to Present at Oppenheimer Healthcare Conference
10. Todd Park, Chief Technology Officer of U.S. Department of Health and Human Services, Joins Opening Keynote Line-Up at 2010 mHealth Summit
11. Genesis Biopharma to Present at the Informed Investors Forum Biotech, Healthcare & Pharma Virtual Conference on October 13
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/16/2014)... Valley, Arizona (PRWEB) September 16, 2014 ... that develops safe and effective products to treat ... the use of a proprietary SPACEā„¢ Technology Platform ... Officer and President will present at the White ... 2014 at the Hyatt Regency Phoenix. In ...
(Date:9/16/2014)... , Sept. 16, 2014  Ascendis Pharma ... TransCon technology to address significant unmet medical needs, ... Phase 2 pediatric study to evaluate once-weekly TransCon ... or GHD.  The full interim results will be ... GRS and IGF Society, being held October 15-18, ...
(Date:9/16/2014)... According to Jeff Howell, Partner of Nidea ... new development in Downtown Toronto is expanding at a ... 755 storeys of new development last week (including three ... dominating the Toronto skyline for the foreseeable future in ... for new development. , As the Toronto city council ...
(Date:9/15/2014)... GREENBELT, Md. , Sept. 15, 2014 /PRNewswire/ ... a leading innovator of scientific products and services ... government-wide One Acquisition Solution for Integrated Services (OASIS) ... Service (FAS). GST was selected to provide the ... in the Small Business (SB) category in Pool ...
Breaking Biology Technology:Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 2Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 2Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 4ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 2ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 3Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 2Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 3
... HUBBARD, Ohio, Sept. 24 /PRNewswire-Firstcall/ -- NanoLogix, Inc. ... an exhibitor and,participant in the "Energy from Biomass ... David L. Lawrence Convention,Center in Pittsburgh, Pennsylvania September ... NanoLogix booth at the Expo, with,Dana Allen, Bret ...
... Seasoned leader brings added expertise to Shire ... England, Sept. 24, Shire plc (LSE: SHP, ... company, announced today that Sylvie,Gregoire has been ... (HGT),business, effective immediately. Sylvie brings more than ...
... BioCryst,Pharmaceuticals, Inc. (Nasdaq: BCRX ) today ... Life Sciences Conference in New York. A live ... 2007 at 2:00 p.m. Eastern,Time may be accessed ... will be archived for seven days. (Logo: ...
Cached Biology Technology:NanoLogix Inc. to Present at EBW Expo & Conference 2007 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 3Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 4BioCryst to Present at UBS 2007 Global Life Sciences Conference 2BioCryst to Present at UBS 2007 Global Life Sciences Conference 3
(Date:9/16/2014)... to make ethical choices such as buying clothing not ... fair-trade coffee, and bringing their own bags when they ... Journal of Consumer Research , ethical consumption is ... emotions about unethical practices into action. , "Advocates of ... and human costs of the products they choose, but ...
(Date:9/16/2014)... practically all vital functions in an organism. For ... particular substances and control immune system responses. Researchers ... function independently of each other, but instead form ... networks, you find many similarities with online social ... of Plant Systems Biology. "Some proteins are good ...
(Date:9/16/2014)... , Sept. 16, 2014  Cross Match Technologies, ... solutions, announced today the launch of its Verifier ... the identity of an individual using their secure ... Sentry rapidly reads credential documents with embedded biometric ... matching the biometric to a live scan of ...
Breaking Biology News(10 mins):Why are consumers willing to spend more money on ethical products? 2Good networkers make prime targets 2Cross Match Launches New Identity Management Handheld Solution 2
... Children's Hospital of Philadelphia leads a multi-center $6.7 million ... of Mental Health (NIMH) to explore a novel approach ... studies and clinical trials in adult patients, the new ... human immunodeficiency virus: sites on immune cells known as ...
... found Envisat's MERIS sensor can detect coral bleaching ... could potentially monitor impacted coral reefs worldwide on ... symbiotic algae living in symbiosis with living coral ... expelled. The whitening coral may die with subsequent ...
... what happens in cells is the work of machines that ... human and other genomes, researchers now have a nearly complete ... manual telling where all the pieces go. A new study ... to answer this question for some of the smallest and ...
Cached Biology News:Federal grant funds research on novel HIV therapy 2Federal grant funds research on novel HIV therapy 3Health of coral reefs detected from orbit 2Many needles, many haystacks 2
... Knockout System provides optimized reagents and protocols ... bacterial genes by insertion of group II ... of group II introns and utilizes a ... group II intron for specific insertion into ...
... monoclonal antibody raised against a partial recombinant MAK. ... a.a. ~ 457 a.a) partial recombinant protein with ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Biology Products: