Navigation Links
Growth Continues for SPIE Student Chapters
Date:11/15/2013

Bellingham, Washington (PRWEB) November 15, 2013

Students at six additional universities can now access diverse career-boosting growth and leadership programs as members of new SPIE, the international society for optics and photonics, Student Chapters, approved by the Board of Directors of the Society at their October meeting in Phoenix, Arizona.

The newest SPIE Student Chapters are at:

  •     National Cheng Kung University (Taiwan)
  •     Indian School of Mines (India)
  •     Institute of Engineering and Management (India)
  •     California State, Chico (USA)
  •     Illinois Wesleyan University (USA)
  •     Utsunomiya University. (Japan)

SPIE has added 26 chapters in 2013 at schools such as Johns Hopkins University, Utsunomiya University, Institute FEMTO-ST, École Polytechnique Fédérale de Lausanne, and University of California, Irvine, and now boasts 238 Student Chapters composed of more than 6,400 members in 47 countries worldwide.

“As the SPIE Student Chapter program continues to grow we welcome new chapters from all over the world. Creating leaders in industry, government, and academics, SPIE student chapters are involved in hosting excellent student conferences and annually inspiring thousands of students with education outreach programs,” said Tasha Chicovsky, SPIE Student Activities Coordinator. "We are continually grateful to our students for their commitment to the field and their work in raising awareness and interest in optics and photonics.”

SPIE welcomed three new Chapters SPIE Optics + Photonics in August as well:

  •     John Hopkins University (USA)
  •     University of California, Irv
    '/>"/>

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Downsizing and the Need for Increased Selling Effectiveness Fuel Delta Points Growth
2. RSB Spine, LLC Announces 2011 Revenue Growth
3. ERT Launches New Website to Support Significant Commercial Growth
4. Phalanx Biotech Group Reports Robust Revenue Growth in 2011
5. Synthetic Biologics to Present at ROTH Annual Growth Stock Conference
6. Palatin Technologies, Inc. to Present at the 24th Annual ROTH OC Growth Stock Conference
7. Carbon nanotubes can double growth of cell cultures important in industry
8. CannaBANK Acquires Rights to License PharmaSpheres Patented Growth System
9. First atomic-scale real-time movies of platinum nanocrystal growth in liquids
10. Profil Institute Reports Record Growth in Number of Clinical Trials in the Pipeline
11. Arthritis Therapeutics Market to 2018 - Novel Oral JAK Inhibitors and Biologic Disease Modifying Anti-Rheumatic Drugs (DMARD) Will Drive Continued Growth Across Key Indications
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:1/15/2014)... 15, 2014 TaiGen Biotechnology Company, Limited ("TaiGen") today ... R-Pharm, a leading Russian pharmaceutical company, to develop and ... Russian Federation , Turkey ... is a novel antibiotic for the treatment of bacterial ...
(Date:1/14/2014)... Carahsoft and CDS Federal Services have scheduled a ... EST (11am PST), “Natural Language Processing: Converting Raw Data ... can turn raw, heterogeneous data into actionable knowledge to ... webinar will last approximately one hour. , Synopsis: Big ...
(Date:1/14/2014)... , Jan. 14, 2014  3D Communications, a leading provider of strategic ... business, and media events in the United States ... associate Virginia Cox , JD, is returning to the firm,s ... Cox re-joins 3D after more than two years of service ...
(Date:1/14/2014)... 2014 EquitiesIQ, a leading informational research ... Alliqua is an emerging biomedical company acquiring, developing, manufacturing, ... market. , Free report download: http://equitiesiq.com/reports/alliqua/ , ... management team and Board, which launched the company’s new ...
Breaking Biology Technology:TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 2TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 3TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 4Webcast - Natural Language Processing: Converting Raw Data into Actionable Knowledge – Hosted by Carahsoft and CDS Federal Services 2Former FDA Associate Commissioner Returns To 3D Communications 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 3
... ... , ... Waterville, ME (Vocus) April 15, 2010 -- Cerealus Holdings, in collaboration with the ... Next Generation Strength + Retention System.” Originally patented by DuPont and later developed ...
... ... attendance at the Partec/Powtech/WCPT6 on April 26-29 in Nuremberg, Germany. Visit ... range including FBRM® C35, PVM® V819, and S400 laboratory probes. In ... three posters and one paper. FBRM® and PVM® technology will also ...
... ... reporting and ad hoc analysis , ... (PRWEB) April 13, 2010 -- Like many customer-oriented organizations, Maine Medical ... its data. The program manages behavioral healthcare for 69,000 recipients in Maine, New ...
Cached Biology Technology:Cerealus Announces Licensing Agreement for Bio-Based Ceregel™, A Next Generation Strength and Retention System 2Track Particle Distribution in Real Time 2Track Particle Distribution in Real Time 3Maine Medical Center Chooses Business Intelligence Solution from Rapid Insight Inc. 2
(Date:4/17/2014)... a novel method to help kidney stone sufferers ... treatment possible., Kidney stones represent a major medical ... left untreated, apart from being particularly painful, they ... In many patients treated successfully, stone recurrence is ... approach to diagnosis and treatment needs to be ...
(Date:4/17/2014)... whereby the genetic information of DNA is used ... have numerous different functions in living organisms. Messenger ... gene expression, by relating the genetic information of ... proteins. , By examining the different types ... organism at a given time, researchers can determine ...
(Date:4/17/2014)... View of Domestication," a special feature of The ... ( PNAS ) published April 29, raises a ... deep history that most of us take for granted. ... in many spots around the globe shifted from hunting ... and plants. , It seems so straightforward and yet ...
Breaking Biology News(10 mins):Rapid and accurate mRNA detection in plant tissues 2Genetic study tackles mystery of slow plant domestications 2Genetic study tackles mystery of slow plant domestications 3Genetic study tackles mystery of slow plant domestications 4
... NYJuly 28, 2011A new study co-authored by Columbia Engineering ... Environmental Science & Technology , shows that reducing ... with "sizable" economic benefits, as well as the expected ... five scientists from around the U.S. who worked on ...
... -- (July 28, 2011) -- The DNA evidence is in, ... more than 1,000 Chinese tallow trees from the United States ... the tallow trees that are overrunning thousands of acres of ... widely known that Franklin introduced tallow trees to the U.S. ...
... the Food and Drug Administration approved a drug called ... African-American patients, claiming in a press release that this ... Invention: How Science, Politics and Big Business Re-create Race ... Roberts, the Kirkland & Ellis Professor at Northwestern University ...
Cached Biology News:New study outlines economic and environmental benefits to reducing nitrogen pollution 2New study outlines economic and environmental benefits to reducing nitrogen pollution 3Genetic evidence clears Ben Franklin 2Genetic evidence clears Ben Franklin 3Divided by race 2
Mouse monoclonal antibody raised against a full length recombinant CSNK2A2. NCBI Entrez Gene ID = CSNK2A2...
... DNA Visualizer Extraction Kit is manufactured ... causing DNA damage byexposure to UV light. ... gel is often used for DNA-cloning work. ... ethidium bromide and exposure of UV light ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Biology Products: