Navigation Links
Grifols Breaks Ground on New IVIG Facility
Date:10/6/2008

The new facility, based in Los Angeles, California is anticipated to be operational in 2013 and will expand the Company's ability to supply its new generation of intravenous immune globulin into the foreseeable future.

LOS ANGELES, Oct. 6 /PRNewswire/ -- Today, Grifols SA (Grifols), a global healthcare company based in Barcelona, Spain, broke ground on a new 92,000 square foot, intravenous immune globulin (IVIG) production facility at its manufacturing complex in Los Angeles, California. This new facility is the initial realization of the $600 million long-range investment plan announced in October 2007 to increase production for Grifols lifesaving coagulation therapies, immune globulins and albumin. Based on construction schedules and rigorous regulatory licensing requirements, it is expected that the facility will become operational for production of the Company's new generation IVIG product in early 2013.

The new facility represents an expansion of Grifols' existing manufacturing capabilities in Los Angeles. "We are committed to continuing to grow our state of the art facilities in Los Angeles and giving back to the community through the creation of new employment opportunities and economic growth," said Gregory Rich, President of Grifols, Inc. the US subsidiary of Grifols, SA. The new facility will provide approximately 300 new jobs to the Los Angeles community and represents an investment of greater than $50 million.

"We commend Grifols' increased commitment to the production of immune globulin therapy. Assuring continued access to this lifesaving medicine means countless people who live with primary immunodeficienies, such as my son, can lead healthy and productive lives," said Marcia Boyle, President and Founder of the Immune Deficiency Foundation, the national patient organization for persons with primary immune diseases. Demand for IVIG has seen steady growth over the past ten years in the US, Europe and other international mark
'/>"/>

SOURCE Grifols SA
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2

Related biology technology :

1. Pennsylvania Governor Rendell Breaks Ground for Global Pharmaceutical Services Companys North American Headquarters
2. Kansas Breaks Into Top 10 in the Nation in Biotech Strength
3. NASA technology helps predict and prevent future pandemic outbreaks
4. Novel Technology Breaks Through Cancer Pain
5. In novel playground, metals are formed into porous nanostructures
6. BioHorizons Global Symposium 2008 Combines Record Attendance with Groundbreaking Technology
7. Environmental Power Holds Ground Breaking Ceremony for Renewable Natural Gas Facility at Rio Leche Estates
8. Liberty Screening Services Hires Top Executive to Meet Explosive Demand for its Background-Screening Services
9. A New Era in Cell Biology: German Company Develops Groundbreaking Alternative to Stem Cell Therapy
10. Center for Molecular Medicine Among First Labs in Nation to Offer Groundbreaking Test to Aid in Treatment of Colorectal Cancer
11. Easily Lift, Transfer and Reposition Patients with Ground-Breaking Liftaem(TM) System from Smart Medical Technology, Inc.
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/17/2014)... (PRWEB) December 17, 2014 Gene ... that it has entered into a technology access ... (ADM) to apply DNA2.0’s proprietary protein engineering technology, ... process. , “We are extremely excited that the ... platform. This proprietary bioengineering technology has now ...
(Date:12/17/2014)... SOUTH SAN FRANCISCO, Calif. , Dec. 17, ... positive results of a Phase 2 study evaluating ... for the treatment of patients with severe, chronic ... the current standard of care, including topical steroids ... endpoint was percent change in Visual Analog Scale ...
(Date:12/15/2014)...  GlassesOff Inc. (OTCBB: GLSO) announced today the appointment ... director of the Company,s Board of Directors. ... its CEO until its acquisition by Stanley Black ... Recognized as the inventor of the first Wi-Fi-based Active ... -based RFID solutions focused on improving operational efficiency, safety ...
(Date:12/13/2014)... (PRWEB) December 12, 2014 Clarassance, a ... announced its new name: Therabron Therapeutics , Inc. ... and bronchioles (a type of structure in the lungs ... company’s mission to develop novel protein therapeutics for the ... directors decided to change the name to mark the ...
Breaking Biology Technology:ADM and DNA2.0 Enter Into Protein Engineering Technology Access and Service Agreement 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 3Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 4AeroScout Founder Joins GlassesOff's Board of Directors 2AeroScout Founder Joins GlassesOff's Board of Directors 3Maryland-based Biotech Company's Path Forward in Treating Respiratory Diseases Sparks Name Change 2
... States Court of Appeals for the Ninth Circuit issued ... v. Netscape Communications Corp. , 9th Cir., No. 00-56648, that ... the Internet. , ,The Playboy case involved "keying," which is ... list of keywords. For instance, a person who searches a ...
... to reboot my washing machine. Not just turning it off ... the power plug from the wall, waited a few moments, ... outlet. Flashing lights, a trill of beeps, and voil: I ... to thinking just how complicated ordinary machines have become, how ...
... joining WTN as a weekly columnist. Her column, The ... opinion articles related to entrepreneurship and venture capital. Particular ... and the lifestyle issues associated with running one's own ... The Millionaire Next Door , which focused on rich ...
Cached Biology Technology:Recent developments in the protection of trademarks on the Internet 2Recent developments in the protection of trademarks on the Internet 3Have you rebooted? 2Have you rebooted? 3Have you rebooted? 4Unique profiles, anecdotes increase Millionaire Womens net worth 2Unique profiles, anecdotes increase Millionaire Womens net worth 3Unique profiles, anecdotes increase Millionaire Womens net worth 4
(Date:12/4/2014)... Fla. , Dec. 3, 2014  Crossmatch™, ... today announced that its DigitalPersona ® Pro ... readers have been deployed throughout First Bank branch ... South Carolina and Virginia. First ... Southern Pines, North Carolina , ...
(Date:11/21/2014)... YORK , Nov. 19, 2014  Earlier this ... at New York College, and one of the most ... biosensor signals that are transmitted from Smartphones to third ... were Smartphones and has one of the earliest known ... discussing its usage in the military, child care, elder ...
(Date:11/18/2014)... -- The Secure Identity & Biometrics Association (SIBA) and ... formation of The Airport Entry and Exit Working ... Biometric Entry and Exit Solutions Framework for Airports ... BORDERPOL, the international non-profit organization that works directly ... border security, traveler and migration systems. ...
Breaking Biology News(10 mins):First Bank Partners with Crossmatch to Increase Log In Security 2First Bank Partners with Crossmatch to Increase Log In Security 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 2Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 4Identity Management, Document Authentication and Biometric Companies Form "The Airport Entry and Exit Working Group", Releasing the Framework to Help Guide the Department of Homeland Security and Congress Towards Solutions 2Identity Management, Document Authentication and Biometric Companies Form "The Airport Entry and Exit Working Group", Releasing the Framework to Help Guide the Department of Homeland Security and Congress Towards Solutions 3
... January 12, 2011 (Toronto) Seven scientists at ... been awarded Young Investigator grant awards by the U.S.-based ... CAMH awards will fund genetic, clinical and neuroimaging studies ... for people with schizophrenia and depression. The ...
... buds on Douglas-fir trees each spring is the result of ... winter, scientists with the U.S. Forest Service,s Pacific Northwest Research ... in the December issue of Science Findings, a monthly publication ... to help managers predict budburst under different scenarios of future ...
... researchers are helping the Pentagon build reliable mind-controlled prosthetic ... rest of their lives. Prosthetic limbs that ... in the laboratory, but there are challenges to making ... obstacles is the neural implants, nearly inevitable failure over ...
Cached Biology News:7 CAMH scientists win Young Investigator awards focused on breakthrough research 27 CAMH scientists win Young Investigator awards focused on breakthrough research 3Winter temperatures play complex role in triggering spring budburst 2University of Houston researchers helping Pentagon build mind-controlled prosthetics 2University of Houston researchers helping Pentagon build mind-controlled prosthetics 3
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... raised against a partial recombinant ... PPP4C (NP_002711, 218 a.a. ... protein with GST tag. ... NM_002720 Protein ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
Biology Products: