Navigation Links
Global Agricultural Biotechnology Industry
Date:12/4/2012

lect Transgenic Crops Approved in South Africa: 1997-2003 III-68

Trends in the African Market III-68

Sub-Saharan Africa - Under Shadow of Food and Poverty Crisis III-68

Tissue Culture Technology Succeeds in African Banana Harvest III-69

Kenya Receives Support to Improve Agribusiness III-69

Key Players III-69

B.Market Analytics III-71

Table 62: Rest of World Recent Past, Current & Future

Analysis for Agricultural Biotechnology by Product

Group/Segment - Transgenic Seeds/ Crops (Soybean, Corn,

Cotton, and Others); and Biopesticides Markets Independently

Analyzed with Annual Sales Figures in US$ Million for Years

2010 through 2018 (includes corresponding Graph/Chart) III-71

Table 63: Rest of World Historic Review for AgriculturalBiotechnology by Product Group/ Segment - TransgenicSeeds/Crops (Soybean, Corn, Cotton, and Others); andBiopesticides Markets Independently Analyzed with AnnualSales Figures in US$ Million for Years 2004 through 2009(includes corresponding Graph/Chart) III-72

Table 64: Rest of World 15-Year Perspective for Agricultural

Biotechnology by Product Group/Segment - Percentage

Breakdown of Dollar Sales for Transgenic Seeds/Crops

(Soybean, Corn, Cotton, and Others); and Biopesticides

Markets for Years 2004, 2011 & 2018 (includes corresponding

Graph/Chart) III-73

IV. COMPETITIVE LANDSCAPE

Total Companies Profiled: 102 (including Divisions/Subsidiaries - 120)

The United States (60)Canada (9)Japan (2)Europe (23)- France (5)- Germany (7)- The United Kingdom (2)- Italy (2)- Rest of Europe (7)Asia-Pacific (Excluding Japan) (22)Middle East (3)Africa (1)

To order this report:Genetically_Modified_Organism,_GMO Industry<
'/>"/>

SOURCE Reportlinker
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19

Related biology technology :

1. MedImmune Announces Winners of Its 6th Annual Global Abstract Competition
2. MarketsandMarkets: Global Prostate Cancer Therapeutics Market worth $6,457 Million by 2020
3. Global Cleantech Cluster Association Names New York City Startup Rentricity to Global Top 10 List
4. StemCyte Adds World Class Talent to its North America and Global Operations
5. Sequenom Named to NASDAQ Global Select Market
6. Synthetic Biology: Emerging Global Markets
7. MacroGenics Receives Milestone Payment as Part of Its Global DARTâ„¢ Alliance with Boehringer Ingelheim
8. Amgen to Present at the 30th Annual J.P. Morgan Global Healthcare Conference
9. Hemodialysis Machine Industry 2012 Global & China Market Research Report - ReportsnReports
10. MarketsandMarkets: Global Seed Treatment Market worth $3430.3 Million by 2016
11. Accuray Surpasses 600 Installations Globally
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:10/22/2014)... and HONG KONG , Oct. ... disease therapeutics enterprise, announced today that rare disease expert ... as vice president, research. Dr. McKew brings more than ... leadership positions at the National Institutes of Health, Wyeth ... by Wyeth). Dr. McKew will lead aTyr,s efforts to expand ...
(Date:10/20/2014)... 20, 2014 /PRNewswire/ - BIOREM Inc. (TSXV: BRM) ("Biorem" or "the ... Q3 orders to $5.8 million and provides a good start to ... North America and one in the ... projects at record levels," said Peter Bruijns , President & ... end of Q3 than they have been for any complete year ...
(Date:10/20/2014)... 20, 2014 Earle Martin ... announced today that Ellen Teplitzky, an experienced attorney ... the pharmaceutical industry, has joined the firm as ... legal services practice. NDA Partners provides legal ... and testimony, to top law firms and their ...
(Date:10/19/2014)... The Asia-Pacific Bromine Market report defines and segments ... forecast of revenue. , Browse through the TOC ... get an idea of the in-depth analysis provided. ... in the Asia-Pacific bromine market, and is supported ... http://www.micromarketmonitor.com/market/asia-pacific-bromine-6741503144.html , Bromine is a volatile and ...
Breaking Biology Technology:aTyr Pharma Appoints John C. McKew, Ph.D., as Vice President, Research 2aTyr Pharma Appoints John C. McKew, Ph.D., as Vice President, Research 3NDA Partners Appoints Ellen Teplitzky, JD as Director of its Legal Services Practice 2The Asia-Pacific Bromine Market is estimated to grow to $4,080.1 million by 2018 - New Report by MicroMarket Monitor 2The Asia-Pacific Bromine Market is estimated to grow to $4,080.1 million by 2018 - New Report by MicroMarket Monitor 3
... N.Y., Nov. 5 BioSpecifics Technologies Corp. (Nasdaq: ... today announced its financial results for the third quarter ... happy that, in September of this year, the FDA,s ... 12-0, the approval of XIAFLEX(TM) for the treatment of ...
... November 5, 2009 Senomyx, Inc. (Nasdaq: SNMX ), ... discover novel flavor ingredients for the food, beverage, and ingredient ... results for the third quarter ended September 30, 2009. ... compared to $4.0 million for the third quarter of 2008, ...
... PLYMOUTH MEETING, Pa., Nov. 5 /PRNewswire-Asia-FirstCall/ -- BMP Sunstone,Corporation (Nasdaq: ... the Company plans to release third quarter 2009 financial results ... The Company will hold a conference call ... quarter 2009 results. Listeners may access the call by,dialing ...
Cached Biology Technology:BioSpecifics Technologies Corp. Reports Third Quarter 2009 Financial Results 2BioSpecifics Technologies Corp. Reports Third Quarter 2009 Financial Results 3BioSpecifics Technologies Corp. Reports Third Quarter 2009 Financial Results 4BioSpecifics Technologies Corp. Reports Third Quarter 2009 Financial Results 5SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 2SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 3SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 4SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 5SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 6SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 7SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 8SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 9SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 10SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 11SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 12SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 13SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 14BMP Sunstone to Report Third Quarter 2009 Financial Results 2
(Date:10/15/2014)... our ability to assess the pandemic risk from strains ... we must not allow ourselves to become complacent that ... international consortium of scientists. , Influenza pandemics arise when ... yet to develop widespread immunity – spreads in the ... the past 100 years, the worst of which – ...
(Date:10/15/2014)... an unexpected extent. The outbreak does not follow the ... a new disease dynamic in regions, where it has ... National Academy of Sciences Leopoldina, acatech – the German ... the German Academies of Sciences and Humanities have presented ... the statement the academies call for the following consequences ...
(Date:10/15/2014)... the 44th Rosenstiel Award for Distinguished Work in Biomedical ... the mechanisms of genomic instability and its implications for ... second alumnus to win the Rosenstiel Award; the first, ... Alt is the Charles A. Janeway Professor of Pediatrics ... an investigator at the Howard Hughes Medical Institute at ...
Breaking Biology News(10 mins):Scientists 'must not become complacent' when assessing pandemic threat from flu viruses 2Academies call for consequences from the Ebola virus epidemic 2Academies call for consequences from the Ebola virus epidemic 3Academies call for consequences from the Ebola virus epidemic 4Academies call for consequences from the Ebola virus epidemic 5Brandeis awards 44th Rosenstiel Award to pioneering geneticist Fred Alt 2
... in Spanish . An Agricultural Research ... other insects over vast acreage so their movements can be ... affordable. That,s according to recently published research by ... Research Center in Maricopa, Ariz., and his collaborators at the ...
... Plants and people alike face critical choices as ... seedsor babies--or many small, poorly-provisioned ones. Different species ... diversity of life forms: Darwin,s "endless forms most ... at the Smithsonian Tropical Research Institute argues that ...
... WI, February 15, 2010 -- Agricultural nonpoint source ... leading sources of pollution in rivers and water ... are making concerted efforts to reduce these pollutions ... As promising and effective BMPs, vegetated buffers are ...
Cached Biology News:New assay helps track termites and other insects 2Stress and trade-offs explain life's diversity: New Smithsonian model 2A review of vegetated buffer efficacy 2
Mouse monoclonal antibody raised against a full length recombinant SLC25A11. NCBI Entrez Gene ID = SLC25A11...
Mouse polyclonal antibody raised against a partial recombinant SYT4. NCBI Entrez Gene ID = 6860...
Agarose II (Low Melt)...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
Biology Products: