Navigation Links
Getting More Life out of Lithium-ion Batteries
Date:7/24/2014

s to investigate the interactions of lithium with a wide variety of carbon substrates, including pristine, defective and strained graphene, planar carbon clusters, nanotubes, carbon edges and multilayer stacks.

Lithium-ion batteries are growing in popularity for electric vehicle and aerospace applications. For example, lithium-ion batteries are becoming a common replacement for the lead acid batteries that have been used historically for golf carts and utility vehicles. Instead of heavy lead plates and acid electrolytes, the trend is to use lightweight lithium-ion battery packs that can provide the same voltage as lead-acid batteries without requiring modification of the vehicle's drive system. In addition, Tesla Motors recently announced a plan to build a lithium-ion battery "gigafactory."

Wood and Rice University's Yuanyue Liu, lead author of the study, were looking for a "descriptor," a characteristic that would capture the essential physics of interactions between lithium and a variety of carbon materials.

"The fact that our descriptor predicts the performance of such a wide variety of materials is surprising," Wood said. "It means the underlying physics is really very similar, even if the structure, morphology or chemistry differs from one candidate to the next. It's really a very simple and elegant finding that could accelerate design and discovery."

The theoretical model also provides guidelines for engineering more effective anodes by modifying the electronic and chemical properties of other candidate materials.

Read the full story at http://www.prweb.com/releases/2014/07/prweb12045095.htm.


'/>"/>
Source: PRWeb
Copyright©2014 Vocus, Inc.
All rights reserved

Page: 1 2

Related biology technology :

1. Jump Start: New Program Aims at Getting Severely Obese Children Treated More Quickly
2. Getting a grip on inventory management using RF
3. Sales Momentum Helps Companies Drive Revenue by Getting Major Account Sales Strategy Right
4. Acne Treatment, Probiotic Action Explains New Insight on Why More Children are Getting Acne
5. Steps for Getting Rid of Bed Bugs without Using Chemicals and Avoiding Them While Traveling Enumerated by My Cleaning Products in Its Latest Post
6. Safety reflector technology from footwear getting new life in detecting bioterror threats
7. Probiotic Action Shares New Insight Why Getting Rid of Bacteria Can Be Bad for Your Health
8. Patheon to Host Complimentary Seminar on “Getting Your Drug through Phase I Early Development Effectively” at Milton Park, UK Facility
9. Lung mucus gel scaffold prevents nanoparticles from getting through
10. Silicon sponge improves lithium-ion battery performance
11. Why lithium-ion-batteries fail
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:7/2/2015)... 2, 2015  Spherix Incorporated (Nasdaq: SPEX ) -- an ... monetization of intellectual property, today announced a litigation update. ... v. Verizon Services Corp. et al. , Case No. ... Eastern District of Virginia , the ... interpreting certain key claims in favor of the Defendants ...
(Date:7/1/2015)... ... July 01, 2015 , ... It is now possible ... using single photon emission computed tomography (SPECT) according to researchers from Amen ... examined over 20,000 brain scans and is believed to be the largest brain imaging ...
(Date:7/1/2015)... AURORA, Colo. and BANGALORE, India ... a global genomic profiling company that uses next generation ... appointment of Scott A. Storrer as chief ... and CEO, he will be responsible for all strategy, ... Vijay Chandru , who has served as Strand,s chairman ...
(Date:7/1/2015)... ... July 01, 2015 , ... A newly launched business plan contest ... the barriers to innovation in life sciences R&D. The Pistoia Alliance President’s Startup Challenge ... of US$15,000 and a period of expert mentorship from a senior industry figure drawn ...
Breaking Biology Technology:Spherix Issues A Litigation Update 2Spherix Issues A Litigation Update 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 2Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 4Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 2Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 3Pistoia Alliance Launches Startup Challenge 2Pistoia Alliance Launches Startup Challenge 3
... , ... ... , , , , ... ...
... from silicon are projected to be a prominent factor ... the promise has far exceeded the reality. While there ... electricity at impressive 20 percent efficiencies, the cost of ... with the Lawrence Berkeley National Laboratory (Berkeley Lab), however, ...
... ... ... ... ...
Cached Biology Technology:Johnson & Johnson Consumer Companies, Inc., Unveils CYTOMIMIC(TM) Technology at 68th Annual Meeting of the American Academy of Dermatology 2Johnson & Johnson Consumer Companies, Inc., Unveils CYTOMIMIC(TM) Technology at 68th Annual Meeting of the American Academy of Dermatology 3Johnson & Johnson Consumer Companies, Inc., Unveils CYTOMIMIC(TM) Technology at 68th Annual Meeting of the American Academy of Dermatology 4Johnson & Johnson Consumer Companies, Inc., Unveils CYTOMIMIC(TM) Technology at 68th Annual Meeting of the American Academy of Dermatology 5Johnson & Johnson Consumer Companies, Inc., Unveils CYTOMIMIC(TM) Technology at 68th Annual Meeting of the American Academy of Dermatology 6Johnson & Johnson Consumer Companies, Inc., Unveils CYTOMIMIC(TM) Technology at 68th Annual Meeting of the American Academy of Dermatology 7Trapping sunlight with silicon nanowires 2Trapping sunlight with silicon nanowires 3NeoStem Enters into SRA with University of Michigan; Funding from NIH Stem Cell Research Grant 2NeoStem Enters into SRA with University of Michigan; Funding from NIH Stem Cell Research Grant 3NeoStem Enters into SRA with University of Michigan; Funding from NIH Stem Cell Research Grant 4NeoStem Enters into SRA with University of Michigan; Funding from NIH Stem Cell Research Grant 5NeoStem Enters into SRA with University of Michigan; Funding from NIH Stem Cell Research Grant 6NeoStem Enters into SRA with University of Michigan; Funding from NIH Stem Cell Research Grant 7NeoStem Enters into SRA with University of Michigan; Funding from NIH Stem Cell Research Grant 8NeoStem Enters into SRA with University of Michigan; Funding from NIH Stem Cell Research Grant 9
(Date:6/23/2015)... RALEIGH, N.C. , June 23, 2015 /PRNewswire/ ... technology, today announced the results of a recent ... unmatched accuracy on the wrist during activity. In ... biometric technology was compared along with the Apple ... for accurately measuring heart rate during activity. The ...
(Date:6/18/2015)... , June 18, 2015 This report ... Million by the following Product Segments, which includes Immunoassay ... Chemiluminescence Immunoassay Systems, Radio Immunoassay Systems, and Nephelometric Immunoassay ... US, Canada , Japan ... Asia-Pacific , Latin America , ...
(Date:6/17/2015)... Maryland , June 17, 2015 ... mit DNA-Tests verbessert den Analyseprozess und senkt Laborkosten    ... Prime Standard: QIA) hat heute in den ... ® für die forensische Analyse ... zur Erstellung genetischer Fingerabdrücke bieten eine integrierte Lösung für ...
Breaking Biology News(10 mins):Valencell Delivers Breakthrough Heart Rate Accuracy on the Wrist 2Valencell Delivers Breakthrough Heart Rate Accuracy on the Wrist 3Global Immunoassay Systems Market 2Global Immunoassay Systems Market 3Global Immunoassay Systems Market 4Global Immunoassay Systems Market 5Global Immunoassay Systems Market 6Global Immunoassay Systems Market 7Global Immunoassay Systems Market 8Global Immunoassay Systems Market 9Global Immunoassay Systems Market 10Global Immunoassay Systems Market 11Global Immunoassay Systems Market 12Global Immunoassay Systems Market 13Global Immunoassay Systems Market 14Global Immunoassay Systems Market 15Global Immunoassay Systems Market 16Global Immunoassay Systems Market 17Global Immunoassay Systems Market 18Global Immunoassay Systems Market 19Global Immunoassay Systems Market 20Global Immunoassay Systems Market 21Global Immunoassay Systems Market 22Global Immunoassay Systems Market 23Global Immunoassay Systems Market 24Global Immunoassay Systems Market 25Global Immunoassay Systems Market 26Global Immunoassay Systems Market 27Global Immunoassay Systems Market 28Global Immunoassay Systems Market 29QIAGEN bringt in den USA neue Kits für die forensische DNA-Analyse auf den Markt 2QIAGEN bringt in den USA neue Kits für die forensische DNA-Analyse auf den Markt 3QIAGEN bringt in den USA neue Kits für die forensische DNA-Analyse auf den Markt 4QIAGEN bringt in den USA neue Kits für die forensische DNA-Analyse auf den Markt 5QIAGEN bringt in den USA neue Kits für die forensische DNA-Analyse auf den Markt 6
... sources are lighting a fire under research to turn biomass ... 20, signed this week by Gov. Rick Perry, compliments research ... The new law requires more renewable energy to be developed ... energy needs and agriculture industry trends with the legislation will ...
... Research led by biologists at the University of California, Berkeley, ... a chain reaction that leads to the increased expression of ... new findings, to be published July 3 in an advanced ... of how the natural killer (NK) cells - which are ...
... that was banned for internal use in the United States ... to block the genetic action of Huntington's disease in mice ... San Francisco VA Medical Center (SFVAMC) researchers. , The study, ... neurologist at SFVAMC, was reported in the August 16, 2005 ...
Cached Biology News:Researchers find ways to turn manure into power 2Researchers find ways to turn manure into power 3New study finds how cells with damaged DNA alert the immune system 2New study finds how cells with damaged DNA alert the immune system 3Old drug shows new promise for Huntington's Disease 2Old drug shows new promise for Huntington's Disease 3
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Biology Products: