Navigation Links
GeneThera Extends its Reach Overseas
Date:6/16/2009

o expand its investor base by applying for the TSX Venture Exchange after speaking with the exchange's vice president.

As discussions progress, the company will release more details.

ABOUT GENETHERA, INC.

GeneThera, Inc. is a molecular biotechnology company located in Arvada, Colorado. The Company's proprietary diagnostic solution is based on a genetic expression assay, GES, a protocol designed to function on a highly automated Fluorogenic PCR platform. This platform enables GeneThera to offer tests that are presently not available from other technologies. The GES is designed for a host of individual diseases, the current priorities being Mad Cow disease, E. coli 0157:H7 and Johne's disease. For more information, contact Dr. Tony Milici at 303-463-6371 or Richard Dopkin at JR Dopkin & Associates LLC at 516-884-3200.

This press release contains forward-looking statements, which are made pursuant to the Safe-Harbor provisions of the Private Securities Litigation Reform Act of 1995. Words such as "intends," "believes," and similar expressions reflecting something other than historical fact are intended to identify forward-looking statements, but are not the exclusive means of identifying such statements. These forward-looking statements involve a number of risks and uncertainties, including the timely development and market acceptance of products and technologies, the ability to secure additional sources of finance, the ability to reduce operating expenses, and other factors described in the Company's filings with the Securities and Exchange Commission. The actual results that the Company achieves may differ materially from any forward-looking statement due to such risks and uncertainties. The Company undertakes no obligation to revise or update any forward-looking statements in order to reflect events or circumstances that may arise after the date of this release.


'/>"/>
SOURCE GeneThera, Inc.
Copyright©2009 PR Newswire.
All rights reserved

0

GOOD

Page: 1 2

Related biology technology :

1. STC.UNM Signs License Option Agreement With GeneThera for E. coli O157:H7 Vaccine
2. [video] Dr. Tony Milici, Chairman and CEO of GeneThera, Inc., Discusses Worldwide Rights to E.Coli Vaccine on WallSt.nets 3-Minute Press Show
3. Insmed Announces That NASDAQ Further Extends Temporary Suspension of Minimum Bid Closing Price Rule
4. Endo Pharmaceuticals Extends Subsequent Offering Period for Indevus Shares Until 5:00 pm EDT on Wednesday, March 18, 2009
5. BVF Acquisition LLC Extends Avigen Tender Offer to April 3, 2009
6. BVF Acquisition LLC Extends Avigen Tender Offer to March 6, 2009
7. BioMed Realty Trust Extends Leases With Vertex Pharmaceuticals Through 2015
8. GlaxoSmithKline Reduces Minimum Tender Condition and Extends Tender Offer To Acquire Genelabs Technologies, Inc.
9. GlaxoSmithKline Extends Tender Offer for Genelabs Technologies, Inc.
10. NASDAQs Temporary Suspension of Minimum Bid Closing Price Rules Extends Insmeds Compliance Date to March 20, 2009
11. Ziehm Imaging Extends its Training Offer
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/17/2009)... Rx Club, the Daveys, the GLOBALS, ,and PM360 Pharma Choice ... ... 17, 2009 -- Chicago-based full-service healthcare communications agency Goble & ... awards programs honoring exceptional creative and interactive work. , , ... with 9 Awards of Excellence for the following creative work: ...
(Date:12/16/2009)... cheap, accurate test to find undetected landmines. , Students ... bacteria that glows green when it comes into contact ... can be mixed into a colourless solution that, when ... indicate the presence of landmines. , Researchers say ... be delivered from the air onto areas thought to ...
(Date:12/16/2009)... Technological University (NTU) signed the Memorandum of Understanding ... Research (CNRS) and the Thales Group of Companies ... three parties are meeting again in Singapore to ... NTU. , Located at the Research Techno ... latest in science and technology to develop innovations ...
(Date:12/16/2009)... microgears in suspended solution by swimming , ... ... Scientists at the U.S. Department of Energy’s (DOE) Argonne National ... bacteria can turn microgears when suspended in a solution, providing ... , , ,“The gears are a million times more massive ...
Breaking Biology Technology:Goble & Associates Creative Work Awarded at Advertising Industry Competitions 2Goble & Associates Creative Work Awarded at Advertising Industry Competitions 3Goble & Associates Creative Work Awarded at Advertising Industry Competitions 4New Singapore-French nanotech lab opens at NTU 2New Singapore-French nanotech lab opens at NTU 3Argonne Scientists Use Bacteria to Power Simple Machines 2Argonne Scientists Use Bacteria to Power Simple Machines 3
... CHICAGO, Dec. 14 Non-surgical, spinal decompression is,probably ... need. And you can,forget about popping toxic pills, ... this amazing technology - for most people - ... Thea Flock is Chicagoland,s most respected authority on ...
... 13 Give the person on your list who,has ... of a Magical Mystical,Pen by world-renowned artist, Karen Sperling., ... Magical Mystical Tour,abstracts, currently exhibited in the Digital Long ... in St. James, NY, through,January 11, 2008., "Karen ...
... presented at San Antonio Breast Cancer Symposium, ... in the rapidly evolving field of molecular diagnostics, ... the,prognostic power of its MammaPrint(R) breast cancer prognosis ... The data show that,MammaPrint(R) can accurately identify a ...
Other Biology Technology:Amazing Treatment Relieves Serious Back Pain Without Dangerous Drugs, Injections or Surgery! 2Artistic Magical Mystical Tours 2MammaPrint(R) Breast Cancer Test Validated in Lymph Node-Positive Breast Cancer Patients 2MammaPrint(R) Breast Cancer Test Validated in Lymph Node-Positive Breast Cancer Patients 3
(Date:12/16/2009)... of microfossils found in ocean sediment cores is illuminating ... a critical period of Earth history. , Around 55 ... epoch, the Earth,s poles are believed to have been ... 25 million years later, ice sheets covered Antarctica and ... change from greenhouse to icehouse conditions resulted from decreasing ...
(Date:12/16/2009)... DC US Secretary of Energy Steven Chu announced ... for their outstanding contributions in research and development supporting ... six winners named today will receive a gold medal, ... honored at a ceremony in Washington, DC early next ... the national, economic and energy security of the United ...
(Date:12/16/2009)... get psyched up for contests, but when these rituals ... down before and during events, they could be causing ... for the symptoms of an injury, not the injury ... focuses on musculoskeletal health and sports medicine. "They may ... certain level, but pain occurs for a reason. It ...
Breaking Biology News(10 mins):From greenhouse to icehouse -- reconstructing the environment of the Voring Plateau 2Secretary Chu announces 2009 Ernest Orlando Lawrence Award winners 2NSAIDs: Take 'em early and often when competing? Think again 2Neuropathic pain 3A The sea provides a new hope of relief 9475 1Neuropathic pain 3A The sea provides a new hope of relief 9475 2100+ Nurses to Rally in SF Wed to Demand Stronger Swine Flu Safety Protections 3A California Hospitals Remain Unprepared Despite First Nurse Death 53680 1100+ Nurses to Rally in SF Wed to Demand Stronger Swine Flu Safety Protections 3A California Hospitals Remain Unprepared Despite First Nurse Death 53680 2100+ Nurses to Rally in SF Wed to Demand Stronger Swine Flu Safety Protections 3A California Hospitals Remain Unprepared Despite First Nurse Death 53680 3Pharmacy Compounds Liquid Mupirocin for the Chronic Sinusitis Patient 13365 1Pharmacy Compounds Liquid Mupirocin for the Chronic Sinusitis Patient 13365 2
... SAN FRANCISCO, CA June 16, 2008 --- iZumi ... independent non-profit biomedical research organization, have announced a major ... for induced pluripotent stem (iPS) cells. , iPS ... and potential to those of human embryonic stem (ES) ...
... 2008, BETHESDA, MD The March of Dimes has ... and will work to address preterm birth globally. The ... of Preterm Birth, supports the national action plan being ... growing crisis of preterm birth. , "The March of ...
... Old muscle got a shot of youthful vigor in a ... Berkeley, setting the path for research on new treatments for ... Parkinson,s diseases. , In a new study to be published ... Nature , researchers identified two key regulatory pathways that ...
Other Biology News:March of Dimes announces Prematurity Campaign expansion at Surgeon General's conference 2March of Dimes announces Prematurity Campaign expansion at Surgeon General's conference 3Stem cell researchers give old muscle new pep 2Stem cell researchers give old muscle new pep 3Stem cell researchers give old muscle new pep 4
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... The BD PhosFlow Perm/Wash Buffer I can ... modified signaling proteins to permeabilize cells and ... cell wash buffer. Because saponin-mediated cell permeabilization ... to keep the cells in the presence ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Biology Products: