Navigation Links
GMO Answers Invites Consumers to Join the Online Conversation during GMO Awareness Month in October
Date:9/13/2013

WASHINGTON, Sept. 13, 2013 /PRNewswire-USNewswire/ -- During GMO Awareness Month this October, the agricultural biotechnology companies that created GMO Answers (www.GMOAnswers.com) are encouraging consumers to visit the website and join the online conversation. October marks more than two months since the launch of GMO Answers, a central online resource for information on GMOs and how our food is grown.

"GMO Answers gives consumers an opportunity to ask questions about GMOs and get answers from the very people who grow our food, and research and promote its health and safety — farmers, scientists, health experts, nutritionists and others. And consumers are responding to our initiative. So far, visitors have submitted more than 500 questions on topics ranging from human health and environmental impact to labeling," Cathleen Enright, Ph.D., spokesperson for GMO Answers, said. "We look forward to answering more questions and giving consumers the facts about the food they eat."

GMO Answers launched in July and will use GMO Awareness Month to build on that momentum and ongoing commitment to responding to the toughest questions. Consumers want to know more about their food and where it comes from.

Recently, GMO Answers commissioned an online, national survey with general consumers and a subset of food-engaged consumers to find out what they know and what they want to know. Respondents self-identified as being interested in issues such as food sourcing, environmental footprint, and GMOs. While the survey found that many are concerned about GMO use on farms, it was clear that consumers have a growing desire for more information about what GMOs really are and how they're used.  Specifically, the survey found that:

  • Almost half (49%) of respondents said they would not be able to define wh
    '/>"/>

SOURCE GMO Answers
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. WellnessFX Launches New Products e-HealthAnswers and Womens Fertility Package
2. Knowledgent to Hold Big Data Immersion Workshop: High-impact Offering Will Provide the Answers to Today’s Critical Big Data Questions
3. Report Says Mold Stirs Herndon High School, My Cleaning Products Asserts Organic-Based and No-Scrubbing Mold Remediation Products Are the Answers to the Mold Problem
4. Distinct Bright Answers Questions on Why Bacteria are Becoming Resistant to Antibiotics
5. Mars, Incorporated Answers Question: How Does Feeding People and Pets Nurture Science and Discovery? At TEDMED 2012
6. Belatrix Software Kicks off Major Innovation Effort and Invites Innovation Expert to Share How Agile + Design Thinking Accelerate Product Innovation
7. Bayer CropScience Invites Young Americans to the Table to Help Solve the Issue of Feeding a Hungry Planet
8. MyCleaningProducts Invites Moms to Join the Green Crusade With Its Eco-Friendly Rust Removers and Other Cleaners
9. PlantCellCulture.com Launched by DianaPlantSciences to Educate Industry and Consumers About Benefits of Plant Cell Culture Technology
10. US Bioactive Wound Care Market 2016: Global Scenario, Trends, Industry Analysis, Size, Share And Forecast, 2012-2016, Report Available Online by Researchmoz.us
11. Worldwide Marine Biotech Market 2016
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:8/21/2014)... His Majesty Willem-Alexander, King of the Netherlands ... His Majesty Willem-Alexander, King of the Netherlands, has announced ... POET-DSM Advanced Biofuels’ Project LIBERTY cellulosic ethanol plant in ... will take part in the Grand Opening Ceremony to ... p.m. and tour the plant. POET-DSM is a joint ...
(Date:8/21/2014)... , Aug. 21, 2014  Decision Resources ... Brazil and Mexico ... uptake of several newly approved agents, the anticipated ... indication and the launch of emerging biologics will ... In particular, the emerging IL-5 inhibitors will introduce ...
(Date:8/21/2014)... -- China Cord Blood Corporation (NYSE: CO ) ... results for the first quarter of fiscal year 2015 ... the US.  The Company will host ... August 29, 2014 to discuss its financial performance and ... followed by a question and answer session.  Interested parties ...
(Date:8/21/2014)... 2014 Ontotext S4 , The ... Ontotext . Now the same enterprise hardened text ... and unstructured data is available to start-ups and mid-size ... technology. Organizations that do not have resources to evaluate ... use S4 since there is no need for on ...
Breaking Biology Technology:His Majesty Willem-Alexander, King of the Netherlands, to Attend Project LIBERTY opening 2His Majesty Willem-Alexander, King of the Netherlands, to Attend Project LIBERTY opening 3Asthma Agents Currently Face a Suboptimal Coverage Environment in Brazil and Mexico, and as the Treatment Armamentarium Expands, Competitiveness Will Further Intensify 2Asthma Agents Currently Face a Suboptimal Coverage Environment in Brazil and Mexico, and as the Treatment Armamentarium Expands, Competitiveness Will Further Intensify 3China Cord Blood Corporation to Report First Quarter of Fiscal 2015 Financial Results 2Ontotext Releases Text Mining & Semantic Technology Running in the Cloud – Welcome to “S4? 2Ontotext Releases Text Mining & Semantic Technology Running in the Cloud – Welcome to “S4? 3Ontotext Releases Text Mining & Semantic Technology Running in the Cloud – Welcome to “S4? 4
... Yingxia,International, Inc. (OTC Bulletin Board: CYXI) ("China Yingxia" ... and nutritional food industry,engaged in the development, manufacture ... raw cactus plants in the People,s,Republic of China ... Ren,Hu will present at the upcoming Roth China ...
... Wall St. Network,s 3-Minute,Press Show is a daily program ... with public company executives on their,company and most recent ... viewers with insight into a company,s,latest news, and its ... Shows air Monday through Friday at: http://tv.wallst.net/3-min-press/3-min-press.php ...
... device company focused on developing, and commercializing interventional ... call scheduled for Tuesday, November 4, 2008 at ... PAUL, Minn., Nov. 4 ,Replidyne, Inc. (Nasdaq: ... that they have entered into a definitive merger ...
Cached Biology Technology:China Yingxia to Present at Roth China Comes to Vegas Conference 2[video] Wall St. Network's 3-Minute Press Show Features Executive Interviews and Highlights Recent Press for the Following: GTHR, BHRT, AGO 2Replidyne and Cardiovascular Systems Sign Merger Agreement 2Replidyne and Cardiovascular Systems Sign Merger Agreement 3Replidyne and Cardiovascular Systems Sign Merger Agreement 4Replidyne and Cardiovascular Systems Sign Merger Agreement 5Replidyne and Cardiovascular Systems Sign Merger Agreement 6Replidyne and Cardiovascular Systems Sign Merger Agreement 7
(Date:8/20/2014)... LAKE CITY Researchers at Huntsman Cancer Institute (HCI) at ... forms of the gene that encodes BCR-ABL, the unregulated ... According to the American Cancer Society, nearly 6,000 new ... Drugs already in use, called tyrosine kinase inhibitors (TKIs), ... They do not cure CML but control it in ...
(Date:8/20/2014)... State University, the Wellcome Trust Sanger Institute and the ... Mycobacterium pinnipedii from skeletons found in Peru ... is a relative of the TB bacterium that affects ... These researchers assume that seals carried the pathogens from ... lions was unexpected" comments Sebastien Gagneux, from the Swiss ...
(Date:8/20/2014)... Bay Area Lyme Foundation, which aims to make Lyme ... new research published in an upcoming issue of the ... . The findings show that ticks that carry ... year, making the threat of Lyme disease year-round. The ... Public Health (CDPH) Vector-borne Disease Section and University of ...
Breaking Biology News(10 mins):Blueprint for next generation of chronic myeloid leukemia treatment 2Lyme disease risk is year-round in Northwest California, according to new study 2Lyme disease risk is year-round in Northwest California, according to new study 3
... Following an agreement between ESA, Krunichev Space Centre and ... and a secondary payload, the technology demonstrator Proba-2 satellite, ... new November launch date follows a rescheduling of the ... Moisture and Ocean Salinity (SMOS) satellite and the secondary ...
... heat shock protein 90 gets steroid receptors into shape ... to targeted therapies for hormone-driven cancers, such as breast ... of Georgia researchers say. "We are trying to ... conformation so they work," says Dr. Ahmed Chadli, biochemist ...
... In the fruit fly,s developing brain, stem cells called ... cell that has a different fate. But neuroblast growth can ... Researchers at Duke-NUS Graduate Medical School in Singapore ... a counterpart in mammals, that can apparently prevent brain tumors ...
Cached Biology News:SMOS and Proba-2 launch rescheduled for November 2Targeting helpers of heat shock proteins could help treat cancer, cardiovascular disease 2Tumor suppressor gene in flies may provide insights for human brain tumors 2
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... The BD PhosFlow Perm/Wash Buffer I can ... modified signaling proteins to permeabilize cells and ... cell wash buffer. Because saponin-mediated cell permeabilization ... to keep the cells in the presence ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Rabbit polyclonal antibody to GluR2...
Biology Products: