Navigation Links
First Patients Enrolled in Phase II Trial With Intravenous Iclaprim in HAP/VAP/HCAP
Date:12/12/2007

data-sets have been transferred and the authorities have confirmed the receipt and navigability of the information. Both the rolling NDA and the electronic format could greatly facilitate the review process.

The first modules of the NDA package are ready and will be filed before year-end 2007. The remaining modules are expected to be transferred and filing is forecast to be completed by the end of February 2008.

Dr Khalid Islam, President and CEO of Arpida Ltd., commented: "We are pleased with the progress made across the several different programmes.

Firstly, initiation of patient enrolment in the Phase II trial with intravenous iclaprim in HAP/VAP/HCAP provides a good basis for the completion of the trial within the planned timelines. HAP/VAP/HCAP is a serious, life-threatening condition with a high medical need. We believe that iclaprim could have a high potential in this indication based on its potent and bactericidal action on MRSA and its good distribution in those lung compartments where the key respiratory pathogens reside."

Dr Islam added: "Moreover, we are very pleased with the results of the ascending dose trial with oral iclaprim, which show a good tolerability at high doses. We are now working to complete the Phase I programme while at the same time discussing with the regulatory authorities regarding the potential next steps in the development path of oral iclaprim.

Work on the NDA for intravenous iclaprim in cSSSI is progressing well. We expect to file the first modules of the package before year-end and complete the filing by the end of February 2008. After finalising the NDA filing, our next steps will focus on the preparation of the commercial launch of iclaprim."

Conference Call

Arpida will host a conference call to discuss these recent developments, today, 11 December 2007, at 3 pm CET. The dial-in numbers are:

+41-(0)91-610-56-00 (Europe)

+44-(0)207-107-06-11 (UK)

+1-(1)866-29
'/>"/>

SOURCE Arpida Ltd
Copyright©2007 PR Newswire.
All rights reserved

Page: 1 2 3 4 5

Related biology technology :

1. Reclast(R) Receives US FDA Approval as First and Only Once-Yearly Treatment for Women With Postmenopausal Osteoporosis
2. GlaxoSmithKline Recognizes University of Michigans Dr. Daniel F. Hayes as the First Recipient of the Gianni Bonadonna Breast Cancer Award
3. Kewaunee Scientific Announces First Quarter Results and Quarterly Dividend
4. Genmab Announces 2007 First Half Year Results
5. Pharsight Achieves First License Sale for Public-Source Database
6. Novare Announces First Ever Single Port Laparoscopic Kidney Removal (Nephrectomy) Using RealHand(TM) HD Instruments
7. ExonHit Therapeutics: Allergan and ExonHits First Collaboration Compound to Begin Human Clinical Trials
8. China Medical Technologies Reports First Quarter Financial Results
9. Pressure BioSciences, Inc. Issued First Patent in Canada
10. Peregrine Pharmaceuticals to Announce First Quarter FY 2008 Financial Results
11. Exelixis Reports Encouraging Interim Data From a Phase 2 Trial of XL647 as First-Line Therapy for Non-Small Cell Lung Cancer
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:8/28/2014)... 2014 SPIE Fellow Glenn Boreman, Professor ... Science and Director of the Center for Optoelectronics and ... Charlotte, and co-founder and Chairman of the Board of ... 2015 Vice President of SPIE, the international society for ... announced recent election results at the Annual General Meeting ...
(Date:8/28/2014)... A new research platform uses a ... tiny structures undergoing stress and heating, an ... designs for microelectronics and batteries., This new ... about how heating and the surface stress ... Researchers have discussed the merits of surface-stress ...
(Date:8/28/2014)... BOSTON , Aug. 28, 2014  Next month, executives ... at three key industry events beginning with Patient-Centered Clinical ... Hotel in Boston , September 4-5. Patient ... , and Aaron Fleishman will share insights on ... how a variety of tactics – from media to mobile ...
(Date:8/28/2014)... Florida State University research team has led to a ... white light, and convert photon energy directly to mechanical ... , Biwu Ma, associate professor in the Department of ... Engineering, created the molecule in a lab about a ... creation has many other unique capabilities. , For example, ...
Breaking Biology Technology:Glenn Boreman, UNC Professor and Plasmonics Co-Founder, Elected to SPIE Presidential Chain 2New analytical technology reveals 'nanomechanical' surface traits 2New analytical technology reveals 'nanomechanical' surface traits 3BBK Worldwide Leads Sessions at Key September Events 2Novel 'butterfly' molecule could build new sensors, photoenergy conversion devices 2
... DIEGO, June 8 , , WHO: ... and panelists discussing life sciences and the business relationships between California ... , CALAsia is an international 2-day forum that will bring ... Asia Pacific region to identify, explore, and further trans-Pacific business endeavors. ...
... International, a leader in enabling and accelerating the global ... today announced a strategic drug co-development partnership with the ... of therapeutic areas and represents one of the first ... company and a Chinese university. , , HUYA ...
... June 8 CSL Limited (ASX: CSL) and Talecris Biotherapeutics, ... their merger agreement, announced on August 12, 2008, under which ... , , Dr. Brian McNamee, CEO and Managing Director ... Federal Trade Commission (FTC) resolved to block the transaction. ...
Cached Biology Technology:BIOCOM's Inaugural CALAsia Forum 'Bridging the Pacific' 2HUYA Bioscience Announces Strategic Collaboration With the Shenyang Pharmaceutical University 2HUYA Bioscience Announces Strategic Collaboration With the Shenyang Pharmaceutical University 3CSL Limited and Talecris Biotherapeutics Agree to Terminate Merger Agreement 2CSL Limited and Talecris Biotherapeutics Agree to Terminate Merger Agreement 3
(Date:8/28/2014)... (Maximizing Access to Research Careers) Program has announced ... of America,s 27th Annual Mouse Molecular Genetics Conference ... Pacific Grove, California. These awards are meant ... and scientists from underrepresented groups into the mainstream ... the participation of young scientists at the Genetics ...
(Date:8/28/2014)... Advocate and Senior Staff Attorney at the Electronic Frontier ... of biometric and mobile commerce experts set to speak ... Tampa, Florida on September 15, ... Rahman, Director, Technology and Strategy at Samsung, and Philippe de ... this year,s event is Mobility at the Crossroads of ...
(Date:8/28/2014)... good examples of complex systems. Their infrastructure equipment ... for cooling, transport to supply fuel, and ICT ... the network chain is interconnected with a wider ... team of UK-based scientists has studied various aspects ... have been published in EPJ B by Gaihua ...
Breaking Biology News(10 mins):Biometrics UnPlugged Welcomes the Electronic Frontier Foundation's Jennifer Lynch to the Mobility at the Crossroads of Commerce and Privacy Summit 2Inter-dependent networks stress test 2
... and Rongchao Jin have successfully used NMR to ... could advance the development and use of the ... approach offers a significant advantage over routine methods ... whether the nanoparticles exist in a both right-handed ...
... School have made an important discovery about the mechanism ... our understanding of how proteins regulate appetite control and ... Head of Metabolic and Vascular Health at Warwick Medical ... 1A, (CPT1) has a switch which is thrown depending ...
... aconites are plants, widely cultivated for their beauty and ... natural group of 650-700 species ranging from Eurasia into ... mountains. The study was published in the open access ... sampled molecular phylogeny for this group has revealed that ...
Cached Biology News:Carnegie Mellon researchers use NMR to determine whether gold nanoparticles exhibit 'handedness' 2Carnegie Mellon researchers use NMR to determine whether gold nanoparticles exhibit 'handedness' 3
Mouse monoclonal antibody raised against a partial recombinant DENR. NCBI Entrez Gene ID = DENR...
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... raised against a partial recombinant NFKBIB. ... 145 a.a) partial recombinant protein with GST tag. ... Accession: BC015528 ... OMIM: 604495, GeneID: ...
... Mouse polyclonal antibody raised against a ... FES (AAH35357, 120 a.a. ~ 250 ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: