Navigation Links
Feeling the heat
Date:1/10/2008

/p>

However the on-going challenge for scientists and engineers has been to make thermoelectric materials that are efficient enough to be practical. The goal is a value of 1.0 or more for a performance measurement called the thermoelectric figure of merit or ZT, which combines the electric and thermal conductivities of a material with its capacity to generate electricity from heat. Because these parameters are generally interdependent, attaining this goal has proven extremely difficult.

In recent years, ZT values of one or more have been achieved in thin films and nanostructures made from the semiconductor bismuth telluride and its alloys, but such materials are expensive, difficult to work with, and do not lend themselves to large-scale energy conversions.

Bulk silicon is a poor thermoelectric material at room temperature, but by substantially reducing the thermal conductivity of our silicon nanowires without significantly reducing electrical conductivity, we have obtained ZT values of 0.60 at room temperatures in wires that were approximately 50 nanometers in diameter, said Yang. By reducing the diameter of the wires in combination with optimized doping and roughness control, we should be able to obtain ZT values of 1.0 or higher at room temperature.

The ability to dip a wafer into solution and grow on its surface a forest of vertically aligned nanowires that are consistent in size opens the door to the creation of thermoelectric modules which could be used in a wide variety of situations. For example, such modules could convert the heat from automotive exhaust into supplemental power for a Freedom CAR-type vehicle, or provide the electricity a conventional vehicle needs to run its radio, air conditioner, power windows, etc.

When scaled up, thermoelectric modules could eventually be used in co-generating power with gas or steam turbines.

You can siphon electrical power from just about any situation in which heat
'/>"/>

Contact: Lynn Yarris
lcyarris@lbl.gov
510-486-5375
DOE/Lawrence Berkeley National Laboratory
Source:Eurekalert  

Page: 1 2 3 4

Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Feeling the heat
(Date:1/15/2014)... 15, 2014 TaiGen Biotechnology Company, Limited ("TaiGen") today ... R-Pharm, a leading Russian pharmaceutical company, to develop and ... Russian Federation , Turkey ... is a novel antibiotic for the treatment of bacterial ...
(Date:1/14/2014)... Carahsoft and CDS Federal Services have scheduled a ... EST (11am PST), “Natural Language Processing: Converting Raw Data ... can turn raw, heterogeneous data into actionable knowledge to ... webinar will last approximately one hour. , Synopsis: Big ...
(Date:1/14/2014)... , Jan. 14, 2014  3D Communications, a leading provider of strategic ... business, and media events in the United States ... associate Virginia Cox , JD, is returning to the firm,s ... Cox re-joins 3D after more than two years of service ...
(Date:1/14/2014)... 2014 EquitiesIQ, a leading informational research ... Alliqua is an emerging biomedical company acquiring, developing, manufacturing, ... market. , Free report download: http://equitiesiq.com/reports/alliqua/ , ... management team and Board, which launched the company’s new ...
Breaking Biology Technology:TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 2TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 3TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 4Webcast - Natural Language Processing: Converting Raw Data into Actionable Knowledge – Hosted by Carahsoft and CDS Federal Services 2Former FDA Associate Commissioner Returns To 3D Communications 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 3
... ... , ... Waterville, ME (Vocus) April 15, 2010 -- Cerealus Holdings, in collaboration with the ... Next Generation Strength + Retention System.” Originally patented by DuPont and later developed ...
... ... attendance at the Partec/Powtech/WCPT6 on April 26-29 in Nuremberg, Germany. Visit ... range including FBRM® C35, PVM® V819, and S400 laboratory probes. In ... three posters and one paper. FBRM® and PVM® technology will also ...
... ... reporting and ad hoc analysis , ... (PRWEB) April 13, 2010 -- Like many customer-oriented organizations, Maine Medical ... its data. The program manages behavioral healthcare for 69,000 recipients in Maine, New ...
Cached Biology Technology:Cerealus Announces Licensing Agreement for Bio-Based Ceregel™, A Next Generation Strength and Retention System 2Track Particle Distribution in Real Time 2Track Particle Distribution in Real Time 3Maine Medical Center Chooses Business Intelligence Solution from Rapid Insight Inc. 2
(Date:4/17/2014)... a novel method to help kidney stone sufferers ... treatment possible., Kidney stones represent a major medical ... left untreated, apart from being particularly painful, they ... In many patients treated successfully, stone recurrence is ... approach to diagnosis and treatment needs to be ...
(Date:4/17/2014)... whereby the genetic information of DNA is used ... have numerous different functions in living organisms. Messenger ... gene expression, by relating the genetic information of ... proteins. , By examining the different types ... organism at a given time, researchers can determine ...
(Date:4/17/2014)... View of Domestication," a special feature of The ... ( PNAS ) published April 29, raises a ... deep history that most of us take for granted. ... in many spots around the globe shifted from hunting ... and plants. , It seems so straightforward and yet ...
Breaking Biology News(10 mins):Rapid and accurate mRNA detection in plant tissues 2Genetic study tackles mystery of slow plant domestications 2Genetic study tackles mystery of slow plant domestications 3Genetic study tackles mystery of slow plant domestications 4
... NYJuly 28, 2011A new study co-authored by Columbia Engineering ... Environmental Science & Technology , shows that reducing ... with "sizable" economic benefits, as well as the expected ... five scientists from around the U.S. who worked on ...
... -- (July 28, 2011) -- The DNA evidence is in, ... more than 1,000 Chinese tallow trees from the United States ... the tallow trees that are overrunning thousands of acres of ... widely known that Franklin introduced tallow trees to the U.S. ...
... the Food and Drug Administration approved a drug called ... African-American patients, claiming in a press release that this ... Invention: How Science, Politics and Big Business Re-create Race ... Roberts, the Kirkland & Ellis Professor at Northwestern University ...
Cached Biology News:New study outlines economic and environmental benefits to reducing nitrogen pollution 2New study outlines economic and environmental benefits to reducing nitrogen pollution 3Genetic evidence clears Ben Franklin 2Genetic evidence clears Ben Franklin 3Divided by race 2
Mouse monoclonal antibody raised against a full length recombinant CSNK2A2. NCBI Entrez Gene ID = CSNK2A2...
... DNA Visualizer Extraction Kit is manufactured ... causing DNA damage byexposure to UV light. ... gel is often used for DNA-cloning work. ... ethidium bromide and exposure of UV light ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Biology Products: