Navigation Links
FDA Approval of Ryanodex® Marks Milestone for Lyotropic Therapeutics
Date:8/6/2014

Richmond, Virginia (PRWEB) August 06, 2014

Lyotropic Therapeutics (Ashland, Virginia) today announced that its license partner, Eagle Pharmaceuticals, has received marketing approval by the U.S. Food and Drug Administration (FDA) for RYANODEX® (dantrolene sodium) for injectable suspension indicated for the treatment of malignant hyperthermia (MH), along with the appropriate supportive measures. Ryanodex was developed and patented by Lyotropic Therapeutics and is licensed exclusively to Eagle Pharmaceuticals.

About Malignant Hyperthermia
MH is an inherited and potentially fatal disorder triggered by certain anesthesia agents in genetically susceptible individuals. Once triggered, a rapidly progressing reaction involving sustained muscle contraction occurs with catastrophic consequences. Essential to the successful treatment of MH is the rapid institution of dantrolene sodium therapy and control of associated symptoms. Until now, dantrolene sodium preparation entailed a time-consuming reconstitution process and required several people for its preparation, a process that can take 15 to 20 minutes to mix, reconstitute and administer. Lyotropic Therapeutics developed Ryanodex to save critical time in preparation and administration of dantrolene sodium. Ryanodex can be prepared and administered in less than one minute by a single healthcare practitioner.

"Rapid administration of dantrolene sodium has long been recognized as key to reversal of MH. FDA approval of Ryanodex marks the availability of a major advance in the clinician’s ability to quickly prepare and deliver dantrolene sodium in the face of a fulminating MH crisis,” said Benjamin Cameransi, Jr., M.D., D.A.B.A., Vice President of Medical Affairs at Lyotropic Therapeutics. “In addition, approval of Ryanodex strongly validates the Company’s strategy of developing clinically significant new drugs backed with sound proof-of-concept data
'/>"/>

Source: PRWeb
Copyright©2014 Vocus, Inc.
All rights reserved

Page: 1 2

Related biology technology :

1. ImQuest Pharmaceuticals Receives FDA Approval to Initiate Clinical Trials of a Vaginal Gel for the Prevention of HIV Transmission to Women
2. Sunovion Pharmaceuticals Canada Inc. Announces Health Canada Approval of APTIOM(TM) (eslicarbazepine acetate) as a Once-Daily Adjunctive Treatment for Partial-Onset Seizures in Patients with Epilepsy
3. Collaborations, FDA Approvals, Appointments, Patents, and Stock Movements - Research Report on Aetna, United Therapeutics, Perrigo, Arena Pharmaceuticals, and Keryx Biopharmaceuticals
4. Savient Receives Approval From Bankruptcy Court To Sell Substantially All Assets To Crealta Pharmaceuticals
5. Perrigo Company And Elan Corporation plc Receive Irish High Court Approval For Perrigos Proposed Acquisition Of Elan
6. CSafe Global Celebrates Six-Year Anniversary of RKN FAA Approval and Launch of Fleet
7. Channel Medsystems Receives Health Canada Approval to Begin Clinical Evaluation of its Innovative Procedure for Heavy Menstrual Bleeding; Hires Mary Edwards as Senior Vice President, Clinical and Regulatory Affairs.
8. Mainz University receives approval for an Alexander von Humboldt Professorship in Physics
9. FDA Advisory Committee Recommends Approval of Simeprevir for Combination Treatment of Genotype 1 Chronic Hepatitis C in Adult Patients
10. Humira and Simponi Have Been Prescribed By Significantly More U.S. Gastroenterologists in 2013 than in 2012, Likely Owing to Their Recent Approvals for Ulcerative Colitis
11. Profound Medical Receives IDE Approval from FDA to Conduct TULSA Clinical Trial for New Treatment for Localized Prostate Cancer
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/22/2014)... 21, 2014   ... Commercial Officer zu KLOX    ... Chief Financial Officer bestellt    KLOX ... seines jüngst zugelassenen Behandlungssystems zur Wundheilung zu beginnen    ... "Unternehmen") ist sehr erfreut, die folgenden personellen Veränderungen anzukündigen: ...
(Date:11/21/2014)... BELLINGHAM, Washington, USA (PRWEB) November 19, 2014 ... used in our lives was shared with more than ... undergraduate and postgraduate students from the University of Otago ... Outreach Grant . The Otago students, members of the ... Southland New Zealand in early September, giving children from ...
(Date:11/21/2014)... 20, 2014 The California ... research organization representing leading California academic institutions, biotechnology, ... PwC US today released a report revealing ... industry growth. The trend shows a 4 percent ... California Biomedical Industry Report indicates that, while ...
(Date:11/21/2014)... Fayetteville, Arkansas (PRWEB) November 20, 2014 ... partners, Pinnacle Ozone Solutions, LLC (Pinnacle), and PCI, ... equipment, announced that they have been selected to ... City of Fayetteville, Arkansas Paul R. Noland Wastewater ... feature BlueInGreen’s patented HyDOZ® gas dissolution ...
Breaking Biology Technology:KLOX Technologies meldet Neubesetzung von Führungspositionen 2KLOX Technologies meldet Neubesetzung von Führungspositionen 3KLOX Technologies meldet Neubesetzung von Führungspositionen 4KLOX Technologies meldet Neubesetzung von Führungspositionen 5Optics and photonics outreach programs share science, spark fascination with light 2Optics and photonics outreach programs share science, spark fascination with light 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 2California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 4City of Fayetteville Leads Nation with Innovative Ozone Technology 2City of Fayetteville Leads Nation with Innovative Ozone Technology 3City of Fayetteville Leads Nation with Innovative Ozone Technology 4
... veteran, was promoted to president of the General Electric Medical ... who left to become CEO at Invitrogen. The division focuses ... systems . , ,It's a dream job for a corporate ... about $9 billion and produced GE CEO and Chairman Jeffery ...
... develops and sells employee scheduling and management products. The ... and co-founder of Suite Scheduler, a former nurse manager ... employees in a facility. , ,Suite Scheduler products are ... up to 90% of the time to create and ...
... That is, until he gets to the better drugs, faster ... the science behind the Madison-based companys products is likely to ... nears the age when diseases and treatments become as common ... the two and a half-year-old company that Vodenlich joined as ...
Cached Biology Technology:CEO Wilson Defines GE's Health-IT Customer 2CEO Wilson Defines GE's Health-IT Customer 3CEO Wilson Defines GE's Health-IT Customer 4Scheduling made easy with Suite Scheduler 2Scheduling made easy with Suite Scheduler 3Chipping Away at Drug Development 2Chipping Away at Drug Development 3
(Date:11/18/2014)... , Nov. 18, 2014   EyeLock Inc. ... solutions, and MorphoTrust USA (Safran), a ... today announced a strategic partnership to offer comprehensive ... vehicle administration (MVA), airport screening and financial services ... solutions, MorphoTrust serves consumers through a nationwide network ...
(Date:11/11/2014)... , Nov. 11, 2014  Forensicon, Inc., a ... firm, is pleased to announce the promotion of ... Director of Digital Forensics. In Schiff,s new role as ... the team of digital forensics examiners and provide leadership ... Photo - http://photos.prnewswire.com/prnh/20141110/157719 ...
(Date:11/7/2014)... Calif. , Nov. 7, 2014  In conjunction with ... Police Departments, The Community Foundation of the Verdugos ... DNA JUSTICE PROJECT," a $250,000 initiative to keep ... initial phase. In its first six months of existence, the ... needed evidence support for local law enforcement. "Because ...
Breaking Biology News(10 mins):EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 2EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 3Yaniv Schiff Promoted to Director of Digital Forensics at Forensicon, Inc. 2Community Foundation Of The Verdugos Unveils Campaign To Fund Glendale-Burbank DNA Justice Project 2
... February 26, 2013, New York, N.Y. and San Diego, Calif. ... tumor in adults, is challenging to treat because the tumors ... more about the causes of tumor cell growth and drug ... new targeted therapies to potentially treat this deadly cancer. ...
... 2013, Reston, VAResearchers will meet at the Society of ... a number of health concerns that have received growing ... of the presentations, scientists will explore how the development ... related exposures might affect the risk assessment of arsenic ...
... Rockville, Md. The Association for Research in Vision ... three keynote speakers, including two Nobel laureates, during the ... Wash. New this year, the ARVO/Alcon Keynote Series ... Christopher Murray, MD, DPhil. Smithies, of the University ...
Cached Biology News:Novel combination therapy shuts down escape route, killing glioblastoma tumor cells 2Scientists explore topical health issues at meeting in Texas 23 distinguished keynote speakers to present during ARVO 2013 Annual Meeting 2
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... sufficient materials for 1,464 array sample elements. , , ... , Blocker BSA in PBS (10X): 50 ml ... BupH Phosphate Buffered Saline: 8 packs , 10% ... Pico Luminol Enhancer: 2 x 25 ml , SuperSignal ...
Biology Products: