(Date:6/18/2013)... WILMINGTON, Delaware , June 18, 2013 /PRNewswire/ ... to announce the release of the HELM biomolecular ... permissive open source MIT licence. HELM ... of a wide range of biomolecules (e.g. proteins, ... render existing small-molecule and sequence-based informatics methodologies impractical ...
(Date:6/18/2013)... -- The "Bioinformatics Market By Sector (Molecular Medicine, Agriculture, ... Data Analysis Services) & Application (Genomics, Proteomics & Drug Design) - Global ... Restraints, and Opportunities in North America , ... and Rest of World. Browse , ... Figures 364 Pages and an in-depth ...
(Date:6/18/2013)... , June 18, 2013 ... ) has announced the addition of the ... and Companies " to their offering. ... report briefly reviews basics of human genome ... applications. Current large and small sequencers are ...
(Date:6/18/2013)... DUBLIN , June 18, 2013 ... Markets ( http://www.researchandmarkets.com/research/cmbgcv/north_american ) has announced ... American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes ... Radiation Therapy (I131, Y-90)], [Applications (Cancer/Oncology, ... to 2017" report to their ...
Breaking Biology Technology:The Pistoia Alliance Releases HELM Biomolecular Representation Standard Open Source Tools 2Bioinformatics Market Worth $7.5 Billion by 2017 2Bioinformatics Market Worth $7.5 Billion by 2017 3DNA Sequencing: Technologies, Markets and Companies - 2013 Report 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 3... Cynosure, Inc.,(Nasdaq: CYNO ), a leading ... aesthetic treatment systems, today announced that the company,will ... call on Tuesday,February 12, 2008 at 9:00 a.m. ... Executive Officer Michael Davin and,Executive Vice President and ...
... Introduced at Informex 2008, REDWOOD CITY, Calif., ... and leading developer of clean manufacturing,processes, today introduced ... can be used by pharmaceutical companies to more,rapidly ... lead,candidates., The Codex(TM) MicroCyp Plate is being ...
... Phase 1 studies show sobetirome, a selective thyroid hormone ... ... versus placebo, ANN ARBOR, Mich., Jan. 29 QuatRx ... endocrine, metabolic and cardiovascular diseases, today,announced results from two Phase ...
Cached Biology Technology:Cynosure to Announce Fourth-Quarter and Full Year 2007 Financial Results on February 12 2Codexis Launches Codex(TM) MicroCyp Platform to Produce Drug Metabolites and Novel Lead Compounds 2Phase 1 Studies Show Promise of QuatRx's Novel Compound, Sobetirome, for Lowering LDL Cholesterol Levels 2Phase 1 Studies Show Promise of QuatRx's Novel Compound, Sobetirome, for Lowering LDL Cholesterol Levels 3(Date:6/17/2013)... bacteria, and algae, is a common component of sugar-free ... the medical field it,s approved by the FDA ... used during surgery as a substance that opens the ... , Now Profs. Ehud Gazit and Daniel Segal of ... and the Sagol School of Neuroscience, along with their ...
(Date:6/17/2013)... Ore. Amphibian populations are declining worldwide and a ... spread by bullfrogs, but a two-year study shows they ... that bullfrogs are a tolerant carrier host that just ... from eggs in controlled experimental conditions, they found at ... , also called Bd or a chytrid fungus, can ...
(Date:6/16/2013)... were fed a high-fat diet and became obese were ... levels of body fat, a new Ohio University study ... offspring, despite their consumption of a low-fat diet, scientists ... Society in San Francisco, Calif. , "We,ve identified a ... of offspring dependent on the pre-conception diet of the ...
Breaking Biology News(10 mins):Artificial sweetener a potential treatment for Parkinson's disease 2Bullfrogs may help spread deadly amphibian fungus, but also die from it 2Obese male mice father offspring with higher levels of body fat 2... Saturday 02 April 2011: Data presented at the ... novel antiviral compounds for the treatment of hepatitis ... by experts and specialists to ensure resistance is ... of HCV resistance in patients treated with NS3-protease, ...
... (NASDAQ: AWRE ), a leading supplier of technology ... that Edmund C. Reiter has resigned, effective April 1, 2011, ... board of the company citing personal reasons. ... have been named co-CEOs and co-Presidents on an interim basis. ...
... huge demands on water resources around the globe. ... major contributor to the nation,s economy, 85% of ... sector. The excessive use of irrigation water has ... where rising demand has deteriorated groundwater resources, depleted ...
Cached Biology News:Data suggest liver experts should take care when prescribing novel antiviral HCV drugs 2Aware, Inc. Announces Resignation of Chief Executive Officer 2Aware, Inc. Announces Resignation of Chief Executive Officer 3Research on satellite imagery aims to advance sustainable agriculture 2... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... The user-friendly Eppendorf Thermomixer R offers ... that require shaking, heating, and cooling. ... expanded its application and temperature control ... each accommodate 24 micro test tubes, ...
...
Biology Products:Biology NavigationMedical Navigation