Navigation Links
FASTMOUNT™ Adapter Enables Faster Connection of TriClamp®-Type Equipment to Mounting Flanges
Date:3/6/2013

nk-and-equipment-for-pressure-vessels/" title="See original Precision Stainless, Inc. pressure vessel parts." onclick="linkClick(this.href)">Precision Stainless, Inc. and Holloway Machine Company, has maintained a “commitment to perfection,” stated Colwell. That pursuit has led to many innovations in custom fabrication, including the FASTMOUNT™ Adapter that enables quick changes of instruments, probes and piping on traditional NA-Connects.

The FASTMOUNT™ Adapter offers other important capabilities as well:

  • Converts existing NA-Connect and H-CONNECT™ sanitary mounting ?anges to a quick-clamp-type design
  • Bolts easily and securely to existing NA-Connect and H-CONNECT™ mounting ?anges
  • Offers immediate use of the adapter without the need for vessel modi?cations, retro?ts or tools

As Sales Engineer Evelyn Gayer stated, the product’s benefits are clearly evident: “It’s great to watch our customers’ reactions when they first witness the FASTMOUNT™ Adapter in action. It is often followed by the realization that their own modi?cation and connection processes could be much faster.” She recounted an example: During a Factory Acceptance Test (FAT) at the HOLLOWAY headquarters for a vessel that had the traditional NA-Connects already installed, the pharmaceutical company BioMarin saw the FASTMOUNT™ Adapter in use and promptly had them installed on their pressure tank. Gayer added, “It’s nice to know this adapter aids so many great companies, including biotech companies like BioMarin, that can help in the fight against serious illness or life-threatening diseases.”

For more information about the FASTMOUNT™ Adapter, other tank components or pressure vessels and tanks, contact a HOLLOWAY AMERICA representative at 417.863.0077 or by email at info(at)HollowayAmerica(dot)com.

Read the full story at http://www.pr
'/>"/>

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

0

GOOD

Page: 1 2 3

Related biology technology :

1. Invisible tool enables new quantum experiments
2. NDIS Approval of the Promega PowerPlex(R) Y23 System Enables More Usable Profiles in Less Time
3. Krishagni Enables University of New South Wales (Australia) to Adopt caTissue Plus
4. New portable device enables RNA detection from ultra-small sample in only 20 minutes
5. Magnetic actuation enables nanoscale thermal analysis
6. Powerful AAC Device With Intel® i7 Processor Enables Natural Communication for Stroke, ALS and Autism Patients
7. Eurofins MWG Operon’s Express Oligos Provide Faster Than Ever Service
8. Bode Technology Launches Same-Day DNA Service For Faster Response to Law Enforcement and Justice System
9. TOKU-E Announces Safer and Faster Dissolving, Dust-Free Grade Sodium Dodecyl Sulfate (SDS) for Electrophoresis and Manufacturing Applications
10. New research could mean faster computers and better mobile phones
11. GenScript Rush Gene Synthesis - Driving Molecular Biology Research Faster
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/18/2013)... WILMINGTON, Delaware , June 18, 2013 /PRNewswire/ ... to announce the release of the HELM biomolecular ... permissive open source MIT licence. HELM ... of a wide range of biomolecules (e.g. proteins, ... render existing small-molecule and sequence-based informatics methodologies impractical ...
(Date:6/18/2013)... -- The "Bioinformatics Market By Sector (Molecular Medicine, Agriculture, ... Data Analysis Services) & Application (Genomics, Proteomics & Drug Design) - Global ... Restraints, and Opportunities in North America , ... and Rest of World. Browse , ... Figures 364 Pages and an in-depth ...
(Date:6/18/2013)... , June 18, 2013 ... ) has announced the addition of the ... and Companies " to their offering. ... report briefly reviews basics of human genome ... applications. Current large and small sequencers are ...
(Date:6/18/2013)... DUBLIN , June 18, 2013 ... Markets ( http://www.researchandmarkets.com/research/cmbgcv/north_american ) has announced ... American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes ... Radiation Therapy (I131, Y-90)], [Applications (Cancer/Oncology, ... to 2017" report to their ...
Breaking Biology Technology:The Pistoia Alliance Releases HELM Biomolecular Representation Standard Open Source Tools 2Bioinformatics Market Worth $7.5 Billion by 2017 2Bioinformatics Market Worth $7.5 Billion by 2017 3DNA Sequencing: Technologies, Markets and Companies - 2013 Report 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 3
... Cynosure, Inc.,(Nasdaq: CYNO ), a leading ... aesthetic treatment systems, today announced that the company,will ... call on Tuesday,February 12, 2008 at 9:00 a.m. ... Executive Officer Michael Davin and,Executive Vice President and ...
... Introduced at Informex 2008, REDWOOD CITY, Calif., ... and leading developer of clean manufacturing,processes, today introduced ... can be used by pharmaceutical companies to more,rapidly ... lead,candidates., The Codex(TM) MicroCyp Plate is being ...
... Phase 1 studies show sobetirome, a selective thyroid hormone ... ... versus placebo, ANN ARBOR, Mich., Jan. 29 QuatRx ... endocrine, metabolic and cardiovascular diseases, today,announced results from two Phase ...
Cached Biology Technology:Cynosure to Announce Fourth-Quarter and Full Year 2007 Financial Results on February 12 2Codexis Launches Codex(TM) MicroCyp Platform to Produce Drug Metabolites and Novel Lead Compounds 2Phase 1 Studies Show Promise of QuatRx's Novel Compound, Sobetirome, for Lowering LDL Cholesterol Levels 2Phase 1 Studies Show Promise of QuatRx's Novel Compound, Sobetirome, for Lowering LDL Cholesterol Levels 3
(Date:6/17/2013)... bacteria, and algae, is a common component of sugar-free ... the medical field it,s approved by the FDA ... used during surgery as a substance that opens the ... , Now Profs. Ehud Gazit and Daniel Segal of ... and the Sagol School of Neuroscience, along with their ...
(Date:6/17/2013)... Ore. Amphibian populations are declining worldwide and a ... spread by bullfrogs, but a two-year study shows they ... that bullfrogs are a tolerant carrier host that just ... from eggs in controlled experimental conditions, they found at ... , also called Bd or a chytrid fungus, can ...
(Date:6/16/2013)... were fed a high-fat diet and became obese were ... levels of body fat, a new Ohio University study ... offspring, despite their consumption of a low-fat diet, scientists ... Society in San Francisco, Calif. , "We,ve identified a ... of offspring dependent on the pre-conception diet of the ...
Breaking Biology News(10 mins):Artificial sweetener a potential treatment for Parkinson's disease 2Bullfrogs may help spread deadly amphibian fungus, but also die from it 2Obese male mice father offspring with higher levels of body fat 2
... Saturday 02 April 2011: Data presented at the ... novel antiviral compounds for the treatment of hepatitis ... by experts and specialists to ensure resistance is ... of HCV resistance in patients treated with NS3-protease, ...
... (NASDAQ: AWRE ), a leading supplier of technology ... that Edmund C. Reiter has resigned, effective April 1, 2011, ... board of the company citing personal reasons.   ... have been named co-CEOs and co-Presidents on an interim basis. ...
... huge demands on water resources around the globe. ... major contributor to the nation,s economy, 85% of ... sector. The excessive use of irrigation water has ... where rising demand has deteriorated groundwater resources, depleted ...
Cached Biology News:Data suggest liver experts should take care when prescribing novel antiviral HCV drugs 2Aware, Inc. Announces Resignation of Chief Executive Officer 2Aware, Inc. Announces Resignation of Chief Executive Officer 3Research on satellite imagery aims to advance sustainable agriculture 2
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... The user-friendly Eppendorf Thermomixer R offers ... that require shaking, heating, and cooling. ... expanded its application and temperature control ... each accommodate 24 micro test tubes, ...
...
Biology Products: