Navigation Links
Exagen Diagnostics Launches Cutting-Edge Lupus Diagnostic
Date:1/9/2012

ALBUQUERQUE, N.M., Jan. 9, 2012 /PRNewswire/ -- Exagen Diagnostics, Inc., a specialty focused molecular diagnostics laboratory that discovers, develops and markets proprietary tests for rheumatologists and gastroenterologists, announced today the launch of Avise SLE, which aids in the diagnosis of lupus (Systemic Lupus Erythematosus).

Avise SLE is a 5-marker panel designed to Rule-In SLE and Rule-Out other rheumatic diseases to help establish the most accurate SLE diagnosis. Specifically, the panel includes testing of ANA, dsDNA, Avise MCV, EC4d and BC4d. The Avise SLE diagnostic differentiates itself by using cell-bound complements because of their increased performance over soluble complements which helps to accurately and consistently diagnose SLE.

Avise SLE is most impactful when ordered as a first step in patient treatment to help physicians with diagnosis by providing:

  • Efficiency - 5 individual markers, 1 blood draw
  • Confidence in Diagnosis - From a panel that rules-in SLE and rules-out other rheumatic diseases
  • Increased Accuracy - Using CB-CAPs technology to achieve 78% sensitivity and 87% specificity for other diseases/97% specificity for normal/healthy patients
  • Convenience - We provide kits, pay shipping costs and return test results in 7 business days

 

"Exagen is excited to offer a breakthrough diagnostic that uses CB-CAPs technology to help accurately determine if a patient has lupus," said Ron Rocca, President and CEO. "Because diagnosing lupus is so difficult and early diagnosis is critical in avoiding major organ damage, developing an accurate diagnostic to fill the unmet need for rheumatologists was a top priority. We have been able to do that with Avise SLE and are pleased to take part in helping physicians gain control over this serious disease."

About Exagen

Exagen Diagnostics,
'/>"/>

SOURCE Exagen Diagnostics, Inc.
Copyright©2010 PR Newswire.
All rights reserved

Page: 1 2

Related biology technology :

1. Eric Tornoe Joins Exagen Diagnostics as President and COO
2. Exagen Diagnostics Awarded $400,000 in Grants Under the QTDP Program
3. SuperNova Diagnostics® to Present at Biotech Showcase™ 2012 During JP Morgan Healthcare Conference January 9 - 12
4. S.E.D. Labs to be Acquired by Quest Diagnostics
5. Acumen Pharmaceuticals Regains Worldwide Rights to Anti-ADDL Antibody Therapeutics and Diagnostics for Alzheimers Disease From Merck
6. SuperNova Diagnostics® to Present at the 23rd Annual Piper Jaffray Healthcare Conference in New York City
7. Quest Diagnostics CE Marks Simplexa™ Test for Cytomegalovirus for Sale in Europe
8. Quest Diagnostics Encourages Denver Area Residents to Enroll in Historic American Cancer Society Prevention Study November 8th - 19th
9. Quest Diagnostics Initiates CEO Succession Process
10. Exosome Diagnostics Announces Additions to Management and Scientific Advisory Board as Company Expands Clinical Validation Studies in Oncology
11. Ambry Genetics First to Offer Exome Sequencing Service for Clinical Diagnostics.
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/16/2014)... Valley, Arizona (PRWEB) September 16, 2014 ... that develops safe and effective products to treat ... the use of a proprietary SPACE™ Technology Platform ... Officer and President will present at the White ... 2014 at the Hyatt Regency Phoenix. In ...
(Date:9/16/2014)... , Sept. 16, 2014  Ascendis Pharma ... TransCon technology to address significant unmet medical needs, ... Phase 2 pediatric study to evaluate once-weekly TransCon ... or GHD.  The full interim results will be ... GRS and IGF Society, being held October 15-18, ...
(Date:9/16/2014)... According to Jeff Howell, Partner of Nidea ... new development in Downtown Toronto is expanding at a ... 755 storeys of new development last week (including three ... dominating the Toronto skyline for the foreseeable future in ... for new development. , As the Toronto city council ...
(Date:9/15/2014)... GREENBELT, Md. , Sept. 15, 2014 /PRNewswire/ ... a leading innovator of scientific products and services ... government-wide One Acquisition Solution for Integrated Services (OASIS) ... Service (FAS). GST was selected to provide the ... in the Small Business (SB) category in Pool ...
Breaking Biology Technology:Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 2Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 2Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 4ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 2ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 3Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 2Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 3
... HUBBARD, Ohio, Sept. 24 /PRNewswire-Firstcall/ -- NanoLogix, Inc. ... an exhibitor and,participant in the "Energy from Biomass ... David L. Lawrence Convention,Center in Pittsburgh, Pennsylvania September ... NanoLogix booth at the Expo, with,Dana Allen, Bret ...
... Seasoned leader brings added expertise to Shire ... England, Sept. 24, Shire plc (LSE: SHP, ... company, announced today that Sylvie,Gregoire has been ... (HGT),business, effective immediately. Sylvie brings more than ...
... BioCryst,Pharmaceuticals, Inc. (Nasdaq: BCRX ) today ... Life Sciences Conference in New York. A live ... 2007 at 2:00 p.m. Eastern,Time may be accessed ... will be archived for seven days. (Logo: ...
Cached Biology Technology:NanoLogix Inc. to Present at EBW Expo & Conference 2007 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 3Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 4BioCryst to Present at UBS 2007 Global Life Sciences Conference 2BioCryst to Present at UBS 2007 Global Life Sciences Conference 3
(Date:9/16/2014)... to make ethical choices such as buying clothing not ... fair-trade coffee, and bringing their own bags when they ... Journal of Consumer Research , ethical consumption is ... emotions about unethical practices into action. , "Advocates of ... and human costs of the products they choose, but ...
(Date:9/16/2014)... practically all vital functions in an organism. For ... particular substances and control immune system responses. Researchers ... function independently of each other, but instead form ... networks, you find many similarities with online social ... of Plant Systems Biology. "Some proteins are good ...
(Date:9/16/2014)... , Sept. 16, 2014  Cross Match Technologies, ... solutions, announced today the launch of its Verifier ... the identity of an individual using their secure ... Sentry rapidly reads credential documents with embedded biometric ... matching the biometric to a live scan of ...
Breaking Biology News(10 mins):Why are consumers willing to spend more money on ethical products? 2Good networkers make prime targets 2Cross Match Launches New Identity Management Handheld Solution 2
... Children's Hospital of Philadelphia leads a multi-center $6.7 million ... of Mental Health (NIMH) to explore a novel approach ... studies and clinical trials in adult patients, the new ... human immunodeficiency virus: sites on immune cells known as ...
... found Envisat's MERIS sensor can detect coral bleaching ... could potentially monitor impacted coral reefs worldwide on ... symbiotic algae living in symbiosis with living coral ... expelled. The whitening coral may die with subsequent ...
... what happens in cells is the work of machines that ... human and other genomes, researchers now have a nearly complete ... manual telling where all the pieces go. A new study ... to answer this question for some of the smallest and ...
Cached Biology News:Federal grant funds research on novel HIV therapy 2Federal grant funds research on novel HIV therapy 3Health of coral reefs detected from orbit 2Many needles, many haystacks 2
... Knockout System provides optimized reagents and protocols ... bacterial genes by insertion of group II ... of group II introns and utilizes a ... group II intron for specific insertion into ...
... monoclonal antibody raised against a partial recombinant MAK. ... a.a. ~ 457 a.a) partial recombinant protein with ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Biology Products: