Navigation Links
Epilepsy Foundation and Epilepsy Therapy Project Finalize Merger To Create Strong, Unified Organization To Support People with Epilepsy

Washington, DC, December 26, 2012 (PRWEB) December 26, 2012

The Epilepsy Foundation (EF) and the Epilepsy Therapy Project (ETP) announced today that their Boards of Directors have unanimously approved the merger of the two organizations. The new organization, known as the Epilepsy Foundation, will fight for more than two million Americans and their families living with epilepsy today and the one in 26 Americans who will develop epilepsy at some point in their lives. The new mission of the Foundation is to stop seizures and SUDEP, find a cure and overcome the challenges created by epilepsy through efforts including education, advocacy and research to accelerate ideas into therapies. This strategic merger of the EF and ETP has garnered tremendous support from leaders in the healthcare advocacy and research communities.

“The Epilepsy Community has an obligation and now an opportunity to step forward with a strong unified voice to bring greater resources to bear at the national and at the local level to improve the lives of people with epilepsy” said Warren Lammert, Chairman and co-founder of the Epilepsy Therapy Project. “The merger of the EF and ETP creates an opportunity, working together with the 47 local affiliates of the Epilepsy Foundation, to be make a real difference through a comprehensive agenda that includes education, advocacy, awareness, local services and supporting research and the development of new therapies in a time frame that matters to people living with epilepsy today.

“Across all diseases and life-threatening conditions, patient-focused organizations – and patients themselves – are leading the way toward better treatments,” said Michael Milken, chairman of FasterCures. “The merged resources of the Epilepsy Therapy Project and the Epilepsy Foundation will give individuals living with the condition – and their families – an even stronger advocate and partner working to accelerate researc

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

Page: 1 2 3 4

Related biology technology :

1. Upsher-Smith Currently Recruiting People With Epilepsy To Evaluate Investigational Rescue Treatment For Seizure Clusters
2. Reverse engineering epilepsys miracle diet
3. BBVA Foundation Unites the Efforts of Massachusetts General Hospital and Barcelonas Vall dHebron Hospital in Biomarker Research for Personalized Cancer Therapies
4. Leaders in Science Join Upcoming Celebration of the 100th Anniversary of the Oldest Science Foundation in America
5. Silence Therapeutics Announces Positive Response by USPTO that Affirms Validity of Four Foundational RNAi Patents
6. Cord Blood America Announces Exclusive Agreement With National Childrens Leukemia Foundation to Store Stem Cells
7. Elsevier Foundation Awards 2011 Grants to Advance Women in Science and Support Libraries in Developing Countries
8. Galien Foundation Announces 2012 Awards Program For Best Biopharmaceutical Products and Best Medical Technology
9. Foundation for Angelman Syndrome Therapeutics (FAST) Funds Human Clinical Trial
10. NeuroPhage Receives Michael J. Fox Foundation Funding for Parkinsons Disease Research
11. Foundation of UMDNJ Receives Grand Challenges Tuberculosis Biomarkers Grant
Post Your Comments:
(Date:1/22/2015)... 2015 Protocol Networks brings independent technology ... of brand-neutral, independent consultants, Protocol Networks has recently announced ... over the years, his company has attracted several clients ... Plainfield, as well as others. With the success of ...
(Date:1/22/2015)... has added the Eppendorf ... portfolio of Eppendorf products. , The Eppendorf Centrifuge 5424/5424 ... 5424/5424 R and receive the following:, , ... or Eppendorf Reference 2 ,     3 Free ...
(Date:1/22/2015)... Madison, WI (PRWEB) January 22, 2015 Dr. ... at the 12th annual Scripps Natural Supplements Pre-Conference seminar on ... Supplements Conference is an annual continuing education conference for health ... 15th and included the topic of probiotics in health. Dr. ...
(Date:1/22/2015)... January 22, 2015 Selexis SA, a ... Research Cell Banks (RCBs) used for drug discovery to ... Banks will include Next-Generation Sequencing (NGS) data ... de-risks biologic manufacturing by ensuring the integrity of the ...
Breaking Biology Technology:Protocol Networks Brings Independent Technology Consulting to the Constitution State 2Eppendorf Announces Promotional Bundle Which Includes: Eppendorf Centrifuge 5424, 3-Pack of Pipettes, and Tips - Available Now at 2Selexis Generated Research Cell Banks Now Fully Sequenced Using Next-Generation Sequencing 2
... AUSTIN, Texas and TORONTO, Oct. 3 Two ... to integrate vibration,therapy into the stem cell harvesting ... company based in Austin,Texas, has signed an exclusive ... of Toronto, Ontario. The partnership,between the two companies ...
... ),AMDL, Inc. (Amex: ADL ), a leading vertically ... US, today announced that the,Company will present at the ... Tuesday, October 7, 2008 at 10:30 a.m. ET. AMDL,s ... Hotel in the Morosco Room., The Maxim Group ...
... Stock Exchange Symbol: MS, EDMONTON, Oct. 3 ... developer in the treatment of multiple sclerosis (MS), ... (DSMB) for the,Company,s U.S. pivotal phase III MAESTRO-03 ... MS has completed a safety analysis,and recommended that ...
Cached Biology Technology:New Partnership Integrates Vibration Therapy Into Stem Cell Procedures 2New Partnership Integrates Vibration Therapy Into Stem Cell Procedures 3AMDL, Inc. to Present at Maxim Group Growth Conference October 7, 2008 2AMDL, Inc. to Present at Maxim Group Growth Conference October 7, 2008 3BioMS Medical's phase III U.S. multiple sclerosis trial receives positive safety review from Data Safety Monitoring Board 2
(Date:12/24/2014)... its launch in December 2014, the 1U™ app ... trying to remember their usernames and passwords through replacing the ... To assist people who have struggled to remember usernames and ... and focuses on redefining identity, announced today that it is ...
(Date:12/22/2014)... DUBLIN , Dec. 22, 2014 Research and ... the addition of the "The Global Watermarking ... ... global digital media watermarking and fingerprinting markets. Watermarking ...
(Date:12/19/2014)... , Dec. 18, 2014 Research and Markets ... "iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & ... ... introduced the fingerprint reading feature with the iPhone 5S. ...
Breaking Biology News(10 mins):1U Offers Best Solution to the Username / Password Dilemma: For FREE! 21U Offers Best Solution to the Username / Password Dilemma: For FREE! 3The Global Watermarking and Fingerprinting Markets 2iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & Sapphire - Technology Report 2
... in a group of heat-loving bacteria by researchers at ... light a fire under next-generation biofuel production. Scientists ... to break down complex plant material such as switchgrass ... make biofuels. Conventional processes involve the addition of commercially ...
... faded since the end of the Cold War, existing ... devastating global impacts. Researchers at the University of ... effects of a hypothetical nuclear war between India and ... in distant countries. The work, by Mutlu Ozdogan ...
... in our bodies. This process is driven by microtubule filaments ... so-called motor proteins in the cytosol can control their dynamics. ... of cell division. It is composed in large part of ... size, shape and mobility of a cell. In a new ...
Cached Biology News:BESC researchers tap into genetic reservoir of heat-loving bacteria 2War-related climate change would reduce substantially reduce crop yields 2
... for high-yield protein expression ,The ... a high-yielding clone of Sf9 cells. Pre-adapted ... Cell Medium, these cells are recommended for ... baculovirus infection or transfection of appropriate vectors. ...
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Mouse monoclonal antibody raised against a partial recombinant QARS. NCBI Entrez Gene ID = QARS...
Biology Products: