Navigation Links
DuPont Wins Bioeconomy Leadership Award
Date:5/2/2013

WILMINGTON, Del. (PRWEB) May 02, 2013

The Symposium on Biotechnology for Fuels and Chemicals (SBFC), today awarded DuPont with its 2013 Bioeconomy Leadership Award. 2013 marks the first year of this award, aimed at honoring an organization for demonstrated and sustained leadership excellence in advancing the development of the biobased economy. DuPont was recognized for its pioneering work in two strategic areas: renewably sourced materials and fuels.

The award will be presented at the annual SBFC conference, which brings together industrial, academic and government experts to discuss the latest progress and breakthroughs in the research, development and deployment of biobased fuels and materials.

“DuPont is committed to the biobased economy. Our approach to realizing that vision is through integrated science. We merge industrial biotechnology with traditional skills in chemistry, materials sciences, agronomy and engineering to accelerate commercial development and deployment of products made in an entirely new, renewable way,” said Mike Arbige, Research and Development leader for DuPont Industrial Biosciences, who will accept the award on behalf of DuPont. “It is an honor to be the first recipient of this award. We will continue to innovate and drive commercial deployment of renewable materials and fuels in order to meet the needs of our growing population.”

In the field of renewably sourced materials, the SBFC recognized DuPont’s first commercial shipments of Bio-PDO™ from its Loudon, Tenn., plant – the first facility to produce the versatile, renewable biobased prod
'/>"/>

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

Page: 1 2 3

Related biology technology :

1. DuPont Receives ‘Patents for Humanity’ Award for Groundbreaking Research to Improve Nutritional Profile of Staple Crop
2. DuPont Tells Science Educators They Are Key to Inspiring Students to Pursue Science Excellence
3. Iowa Educator Receives DuPont AgriSCIENCE Award for Teaching Excellence
4. DuPont Collaborates with Agricultural Educators to Reach More Students
5. DuPont Tate & Lyle Bio Products Announces Novel Application for Zemea® Propanediol
6. DuPont Joins Israel’s Office of the Chief Scientist Global Enterprise R&D Cooperation Framework
7. DuPont Pioneer and Mendel Biotechnology, Inc. Collaborate to Improve Water Use Efficiency and Photosynthesis in Corn
8. DuPont Tate & Lyle Bio Products Announces Winner of Zemea® Innovation Award
9. Genomatica and DuPont Tate & Lyle Bio Products Successfully Produce 1,4-Butanediol (BDO) on Commercial Scale
10. DuPont Pioneer Launches Next Generation T Series Soybeans
11. DuPont, American Farm Bureau Foundation Invests $250,000 in My American Farm Web Education Program
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/24/2014)... “Preparative & Process Chromatography Market by Instrument ... Buffers, Valves, Guages, Seals), Accessories, Services, End User ... 2019” provides a detailed overview of the major ... strategies impacting the preparative and process chromatography market ... revenue and share analysis. , Full Copy ...
(Date:12/24/2014)... Island, New York (PRWEB) December 23, 2014 ... and the Long Island Affiliate of ITRA Global, the national ... slow but steady recovery. This is evidenced by the ... the strong stock market. Low energy costs have held ... The only negative is the housing market remaining soft. ...
(Date:12/24/2014)... , Dec. 23, 2014 China ... the "Company"), a leading fully integrated plasma-based biopharmaceutical ... announced that its majority-owned subsidiary, Shandong Taibang Biological ... ("GMP") certification from the China Food and Drug ... production facility. As previously disclosed in the Company,s ...
(Date:12/24/2014)... PARIS and NEW YORK ... data from its open-label pilot study of mazindol in ... Design, Development and Therapy in December 2014 . ... of mazindol in children with attention deficit/hyperactivity disorder" ( ... 2014 Dec 1;8:2321-2332. eCollection 2014 ) ...
Breaking Biology Technology:Preparative and Process Chromatography Market is expected to reach $9 billion by 2019 - New Report by Marketsandmarkets 2Preparative and Process Chromatography Market is expected to reach $9 billion by 2019 - New Report by Marketsandmarkets 3Preparative and Process Chromatography Market is expected to reach $9 billion by 2019 - New Report by Marketsandmarkets 4ITRA Global Reports Long Island Is Out of Sync With The National Office Market 2ITRA Global Reports Long Island Is Out of Sync With The National Office Market 3China Biologic Receives GMP Certification for New Coagulation Factor Facility 2China Biologic Receives GMP Certification for New Coagulation Factor Facility 3Redefining ADHD: A New Approach & A Shift of Paradigm in ADHD Therapeutics 2Redefining ADHD: A New Approach & A Shift of Paradigm in ADHD Therapeutics 3
... Polytechnic Institute Professor James Jian-Qiang Lu was recognized ... toward the design and realization of 3-D integrated ... Department of Electrical, Computer, and Systems Engineering (ECSE) ... D. Ashman Achievement Award for 2010 from the ...
... Intarcia Therapeutics. Inc today announced that Kurt ... presenting at the Lazard Capital Markets 7th Annual ... Tuesday, November 16, 2010 at 1:40pm local time ... (Logo:   http://photos.prnewswire.com/prnh/20050301/SFTU126LOGO ) ...
... 11, 2010 StemCyte, Inc., one of the world,s ... is proud to announce that the Company has been ... Internal Revenue Service,s Qualifying Therapeutic Discovery Project (QTDP) program ... than 250 employees. The Patient Protection and ...
Cached Biology Technology:Rensselaer Polytechnic Institute professor James Lu garners award for research on 3-D computer chips 2Intarcia Therapeutics Executive Chairman, Kurt Graves to Present at Lazard Capital Markets 7th Annual Healthcare Conference 2StemCyte Awarded $488,950 for Advanced Therapeutic Applications of Umbilical Cord Blood Stem Cells from the Qualifying Therapeutic Discovery Project (QTDP) 2
(Date:12/10/2014)... NEW YORK , Dec. 8, 2014 You,ve ... online banking account but can,t remember your password, site key ... birthday? Who was your first grade teacher? ... launches the app that will finally put an ... PINs – 1U TM . 1U leverages a ...
(Date:12/10/2014)... Forest Baptist Medical Center today announced plans for a ... Funding for this $50 million capital project is part ... launched next summer. The medical education ... R.J. Reynolds Tobacco Company complex, adjacent to 525@vine in ... plans to be ready to welcome medical students in ...
(Date:12/10/2014)... , Dec. 08, 2014 Research and Markets ... addition of the "Biometrics Market in Japan ... http://photos.prnewswire.com/prnh/20130307/600769 The ... such as rural banking and upgradation of the ... witnessed in the market. Besides the aforementioned projects, ...
Breaking Biology News(10 mins):The Password is Finally Dead: Launch of 1U Mobile App Eliminates Need for All Usernames and Passwords 2The Password is Finally Dead: Launch of 1U Mobile App Eliminates Need for All Usernames and Passwords 3Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 2Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 3Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 4Biometrics Market in Japan 2014-2018: Key Vendors are DDS, Fujitsu, Hitachi and NEC 2
... 28, 2008) Just three years after it was discovered, ... to the Wildlife Conservation Society, which recently published the first-ever ... "kipunji," the large, forest-dwelling primate hovers at 1,117 individuals, according ... journal Oryx . The population estimate was ...
... at Houston say they are the first to provide ... may be an autoimmune disease. Their research could provide ... Findings appear online in Nature Medicine on ... Xia, M.D., Ph.D., an assistant professor of biochemistry and ...
... to dangerously low levels in diseases such as anemia ... cells, doctors filter platelets from donated blood, but this ... and cause other side effects in patients who need ... have been trying to generate platelets from embryonic stem ...
Cached Biology News:Pre-eclampsia may be autoimmune disease 2Pre-eclampsia may be autoimmune disease 3
Agarose II (Low Melt)...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
Biology Products: