Navigation Links
Distinct Bright Shares New Insight Which Homemade Cleaners are the Safest
Date:3/20/2013

Miami, FL (PRWEB) March 20, 2013

The Saint Cloud Times reports that the rise in DIY, ( Do It Yourself) household cleaners and tip sharing has become a buzz on social media platforms. With many so called “cleaning experts” sharing tips on how to clean a home with everyday products, DistinctBright offers tips as a healthy cleaning authority on which household products are safest to use around the home. The recent article highlights that while using known solutions may seem “safer” than buying chemicals in the store, some DIY cleaning solutions can be equally as harmful to kids and pets, as store bought ones.

Distinct Bright Spokesman, Fernando Perez offers which DIY cleaners may be the safest, "The powers of lemon Juice, several types of vinegars, and baking soda are the primary sources in many homemade cleaners being created. These three cleaners are also the safest, but should still be kept at bay from children and pets, as large quantities could be harmful.”

Perez Suggests that a combination of vinegar and water can be a great cleaner for windows and glass, while adding lemon to the mixture helps cover the scent. Additional benefits of using vinegar and lemon reside in the bad bacteria killing power of both liquids. Perez offers that to continue to protect surfaces from bad bacteria, a combination of a probiotic cleaner like Distinct Bright and homemade solution from the above mentioned products are the safest way to protect a home and pets from bad bacteria and grime.

Distinct Bright is an advanced cleaner that uses nature’s power to clean, sanitize and protect personal items like jewelry. Distinct Bright contains no ammonia or harmful chemicals and is easy on the skin. Distinct Br
'/>"/>

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

Page: 1 2

Related biology technology :

1. DistinctBright, Probiotic Cleaner, Announces their Probiotic Cleaner is Safe for Pets
2. DistinctBright Shares New Tips on How to Clean Pandora Bracelets with their Probiotic Cleaner
3. Distinct Bright Shares New Insights on How Cleaning Jewelry Might Be Destroying it
4. DistinctBright "The Best Probiotic Cleaner Company" Shares Tips for Green Cleaning
5. How to Do Spring Cleaning the Healthy Way: DistinctBright Explores the Overlooked Dangers of Household Cleaning Products and offers Natural Cleaning Solutions
6. Distinct Bright Answers Questions on Why Bacteria are Becoming Resistant to Antibiotics
7. Early career distinction: Prestigious award recognizes physicists work in electron dynamics
8. Cieri Media Announces New Science Series 'Bright Ideas' Focusing on Latest Inventions
9. Elsevier and the Dutch Fulbright Center Start Collaboration to Support Early Career Researchers in the Netherlands
10. Quantum dots brighten the future of lighting
11. Experts Strengthen Albright Stonebridge Groups Global Reach
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:1/15/2014)... DTS Language Services, Inc . is ... for Life Science organizations who need document translations. Clients ... of their documents in advance with a selection of nearly ... translations, often a critical factor in clinical and scientific fields, ...
(Date:1/14/2014)... Doylestown, PA (PRWEB) January 14, 2014 Date: ... p.m. , Location: Warrington Country Club, 1360 Almshouse Road, Warrington, ... only national nonprofit organization solely dedicated to finding a cure ... those affected worldwide, will host its annual Crystal Ball on ...
(Date:1/14/2014)... (PRWEB) January 14, 2014 EquitiesIQ, a ... Inc. (OTCQB: ALQA). Alliqua is an emerging biomedical company ... the wound care market. , Free report download: ... with a seasoned management team and Board, which launched ...
(Date:1/14/2014)... Jan. 14, 2014  RXi Pharmaceuticals Corporation (OTCQX: RXII), ... commercializing innovative therapies addressing major unmet medical needs ... the Notice of Allowance from the United States ... RNAi compounds (sd-rxRNA®), for the treatment of fibrosis. ...
Breaking Biology Technology:DTS Improves Efficiency for Life Science Document Translations 2Hepatitis B Foundation to Host Annual Crystal Ball Gala 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 3RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 2RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 3
... CARY, N.C., May 19, 2011 ... its flexible 100% web-based Life Science Study Management ... successfully used globally by Leading European and USA ... eStudy,s on-line study design, management, communication, data collection ...
... CLARA, Calif., May 19, 2011 The 2012 federal ... National Nanotechnology Initiative (NNI), a federal interagency research and ... manipulation of matter at the nanoscale—a measurement of particles ... meter) in size.  While nanoscale materials are found in ...
... Inc., a Massachusetts-based biopharmaceutical company, announced today that it ... Administration on a Special Protocol Assessment (SPA) for a ... agent for patients with newly diagnosed prostate cancer. The ... with definitive results expected by 2015. The randomized study ...
Cached Biology Technology:Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 2Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 3Environmental Training Center Prepares Companies to Handle Nanotechnology Environmental and Human Safety Impacts 2Advantagene Announces SPA Agreement With FDA to Launch Phase 3 Trial for Novel Vaccine Aimed at Preventing Prostate Cancer Recurrence 2
(Date:4/17/2014)... NJ. April 16, 2014. Kessler Foundation has been ... million from the Department of Defense Spinal Cord ... principal investigator for the randomized, double-blinded, controlled, multi-site ... bone and muscle strength after spinal cord injury. ... & Engineering Research at Kessler Foundation. Two additional ...
(Date:4/17/2014)... births, Down syndrome - or trisomy 21 - is ... results from a chromosomal abnormality where cells of affected ... of the human genome). A study conducted by Stylianos ... Medicine and Development at the University of Geneva (UNIGE) ... light on how the extra chromosome 21 upsets the ...
(Date:4/17/2014)... ago, Katia Silvera , a postdoctoral scholar at the ... field trip in a mountainous area in central Panama when ... , Unable to identify it, they contacted German Carnevali, a ... be an unnamed species. So Carnevali recently named it after ... genus name, comprising about 40 species in the world. ...
Breaking Biology News(10 mins):Kessler Foundation awarded Department of Defense grant for spinal cord injury research 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 3Orchid named after UC Riverside researcher 2Orchid named after UC Riverside researcher 3
... fruit flies eat like horses. Hatching inside over-ripe fruit where they ... sends them an offer they cant refuse. To survive, they must ... they avoid food as if it were poison. Only then can ... to lay their own eggs. Now, a team of researchers ...
... migration to EAC ePassport technology, DALLAS, May ... (Nasdaq: ENTU ) will provide its proven ... authenticate sensitive,biometric information stored on machine readable travel ... will be available to nearly 23 million,citizens by ...
... Board: BKYI) today announced plans to release first quarter,2008 financial ... conjunction with the release, BIO-key has scheduled a conference call,which ... 15, 2008 at,9:00 a.m. Eastern Time., What: ... Call ...
Cached Biology News:Fruit fly avoidance mechanism could lead to new ways to control pain in humans 2Entrust, Hewlett Packard Partner to Deploy Taiwanese ePassports, Authenticate Biometric Data 2Entrust, Hewlett Packard Partner to Deploy Taiwanese ePassports, Authenticate Biometric Data 3BIO-key(R) Announces First Quarter 2008 Earnings Release and Conference Call Schedule 2
Mouse monoclonal antibody raised against a full length recombinant CSNK2A2. NCBI Entrez Gene ID = CSNK2A2...
... DNA Visualizer Extraction Kit is manufactured ... causing DNA damage byexposure to UV light. ... gel is often used for DNA-cloning work. ... ethidium bromide and exposure of UV light ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Biology Products: