Navigation Links
Disease and Therapy Review: Asthma Now Available at ReportsandReports
Date:6/29/2010

from key industry secondary data sources, such as the Timely Data Resources Incidence and Prevalence Database, and Lange's Current Medical Diagnosis and Treatment. This information is supplemented by reviews of analyst reports, company reports, and medical websites. Sources and references are provided.

    Table of Contents

    I. OVERVIEW

       Symptoms and severity

    II. INCIDENCE AND PREVALENCE

    Incidence Table (US, Italy)
    Prevalence Table (US, Canada, Mexico, England, UK, France, Germany,
                      Italy, Spain, China, India, Japan, Turkey, Australia,
                      Worldwide)

    III. DIAGNOSIS AND TREATMENT

    Guidelines for diagnosis and management
    Long-term medications
    Quick-relief medications
    Approach to treatment of asthma exacerbations
    Treatment rates

    IV. DOSING AND TREATMENT COSTS

    V. MARKET SIZE

    VI. COMMENTS

    VII. REFERENCES/RESOURCES


    Browse all HealthCare Reports at
http://www.reportsandreports.com/market-research/healthcare/
    Browse all Timely Data resources Reports at
http://www.reportsandreports.com/Publishers/timely-data-resources/

Related Reports

Disease and Therapy Review: Chronic Obstructive Pulmonary Disease (COPD) (http://www.reportsandreports.com/market-reports/disease-and-therapy-review-c
'/>"/>

SOURCE MarketsandMarkets
Copyright©2010 PR Newswire.
All rights reserved

Page: 1 2 3 4 5

Related biology technology :

1. Disease and Therapy Review: Bladder Cancer Now Available at ReportsandReports
2. Gastrointestinal Disorders Therapeutics to 2016 - High Unmet Needs Triggering Strong Growth in Crohns Disease and Irritable Bowel Syndrome Markets Now Available at ReportsandReports
3. Type 2 Diabetes Patients With Long-Standing Disease Achieved Glycemic Control When BYETTA(R) Was Added to Lantus(R)
4. Shire Receives CHMP Positive Opinion for VPRIV(TM) (velaglucerase alfa) for the Treatment of Type 1 Gaucher Disease in the European Union
5. Research from Rensselaer Polytechnic Institute professor offers clues to Alzheimers disease
6. New Study Showed the Impact of Gastrointestinal Disorders in Patients With Parkinsons Disease
7. BioCrossroads Invests in Indianapolis Biotech Company Developing Treatments for Alzheimers Disease
8. Zymes’ Water Soluble CoQ10 Decreases Symptoms in Animal Models of Parkinson’s Disease
9. EnVivo Initiates Phase IIb Alzheimers Disease Trial For EVP-6124
10. New inhalable measles vaccine may lead to vaccines for other diseases
11. Latest breakthroughs in technology expand options for diagnosing and treating disease
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:1/15/2014)... DTS Language Services, Inc . is ... for Life Science organizations who need document translations. Clients ... of their documents in advance with a selection of nearly ... translations, often a critical factor in clinical and scientific fields, ...
(Date:1/14/2014)... Doylestown, PA (PRWEB) January 14, 2014 Date: ... p.m. , Location: Warrington Country Club, 1360 Almshouse Road, Warrington, ... only national nonprofit organization solely dedicated to finding a cure ... those affected worldwide, will host its annual Crystal Ball on ...
(Date:1/14/2014)... (PRWEB) January 14, 2014 EquitiesIQ, a ... Inc. (OTCQB: ALQA). Alliqua is an emerging biomedical company ... the wound care market. , Free report download: ... with a seasoned management team and Board, which launched ...
(Date:1/14/2014)... Jan. 14, 2014  RXi Pharmaceuticals Corporation (OTCQX: RXII), ... commercializing innovative therapies addressing major unmet medical needs ... the Notice of Allowance from the United States ... RNAi compounds (sd-rxRNA®), for the treatment of fibrosis. ...
Breaking Biology Technology:DTS Improves Efficiency for Life Science Document Translations 2Hepatitis B Foundation to Host Annual Crystal Ball Gala 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 3RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 2RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 3
... CARY, N.C., May 19, 2011 ... its flexible 100% web-based Life Science Study Management ... successfully used globally by Leading European and USA ... eStudy,s on-line study design, management, communication, data collection ...
... CLARA, Calif., May 19, 2011 The 2012 federal ... National Nanotechnology Initiative (NNI), a federal interagency research and ... manipulation of matter at the nanoscale—a measurement of particles ... meter) in size.  While nanoscale materials are found in ...
... Inc., a Massachusetts-based biopharmaceutical company, announced today that it ... Administration on a Special Protocol Assessment (SPA) for a ... agent for patients with newly diagnosed prostate cancer. The ... with definitive results expected by 2015. The randomized study ...
Cached Biology Technology:Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 2Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 3Environmental Training Center Prepares Companies to Handle Nanotechnology Environmental and Human Safety Impacts 2Advantagene Announces SPA Agreement With FDA to Launch Phase 3 Trial for Novel Vaccine Aimed at Preventing Prostate Cancer Recurrence 2
(Date:4/17/2014)... NJ. April 16, 2014. Kessler Foundation has been ... million from the Department of Defense Spinal Cord ... principal investigator for the randomized, double-blinded, controlled, multi-site ... bone and muscle strength after spinal cord injury. ... & Engineering Research at Kessler Foundation. Two additional ...
(Date:4/17/2014)... births, Down syndrome - or trisomy 21 - is ... results from a chromosomal abnormality where cells of affected ... of the human genome). A study conducted by Stylianos ... Medicine and Development at the University of Geneva (UNIGE) ... light on how the extra chromosome 21 upsets the ...
(Date:4/17/2014)... ago, Katia Silvera , a postdoctoral scholar at the ... field trip in a mountainous area in central Panama when ... , Unable to identify it, they contacted German Carnevali, a ... be an unnamed species. So Carnevali recently named it after ... genus name, comprising about 40 species in the world. ...
Breaking Biology News(10 mins):Kessler Foundation awarded Department of Defense grant for spinal cord injury research 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 3Orchid named after UC Riverside researcher 2Orchid named after UC Riverside researcher 3
... 2013) The Algae Biomass Organization (ABO), the trade ... of "Industrial Algae Measurements, Version 6.0" (IAM 6.0), ... by the organization for measuring and comparing algae ... new technologies to create fuels, feeds, nutritional supplements, ...
... this Moderate Resolution Imaging Spectroradiometer (MODIS) satellite image collected on ... Terra satellite and actively burning areas, detected by MODIS,s thermal ... is banned in Indonesia, but that does not always stop ... unusual dry spell in the area (this is usually the ...
... influence actual heart health, according to new research. A study ... ways in which your spouse is supportive and how ... on your overall cardiovascular health. The findings reveal that ... other as ambivalent that is, sometimes helpful and sometimes ...
Cached Biology News:ABO updates standards for measuring algae industry operations 2ABO updates standards for measuring algae industry operations 3ABO updates standards for measuring algae industry operations 4Heart disease risk linked with spouses' social support 2
Mouse monoclonal antibody raised against a full length recombinant CSNK2A2. NCBI Entrez Gene ID = CSNK2A2...
... DNA Visualizer Extraction Kit is manufactured ... causing DNA damage byexposure to UV light. ... gel is often used for DNA-cloning work. ... ethidium bromide and exposure of UV light ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Biology Products: