Navigation Links
Danish Hotspot in Personalized Medicine
Date:11/12/2007

COPENHAGEN, November 12 /PRNewswire/ -- The Danish biotech cluster known as Medicon Valley has, within a short period, grown into a global hotspot in the field of personalized medicine, and finds itself increasingly in favor among big pharma and big biotech. Experience Danish competencies at the 3rd Annual Personalized Medicine Meeting in San Francisco from 12th - 13th November.

With over 10 research institutions and 15-20 private companies engaged in personalized medicine, the Danish biotech cluster known as Medicon Valley has in record time become a strong player in currently one of the hottest research fields within the pharmaceutical industry.

Several of these Danish players operate on an individual basis, although many are also involved in collaborative research efforts, including the Danish Center for Translational Breast Cancer Research, the siRNA Delivery Center, the Danish microRNA consortium and special research departments at the University of Copenhagen and the Technical University of Denmark.

This is one reason why Denmark is participating in 3rd Annual Personalized Medicine Meeting in San Francisco, where Director of Knowledge and Communications at Danish Medicines Agency Kaare Geil is in the panel discussion on the second day to give a European/Danish perspective on the topic: Who Will Pay? The Economics of Personalized Medicine. Kaare Geil says: "Denmark has a national cancer plan, which is very clear on personalized medicine. The ministry of health as well as the ministry of science, has specific programs to support and enable the implementation of personalized medicines in our systems."

S0ren M. Echwald, M.Sc., Ph.D., who is Vice President and responsible for Business Development at Exiqon will be hosting a table discussion at the conference. "Exiqon is very committed to our diagnostic vision, and is active with several diagnostic projects," says S0ren M. Echwald. "With Exqion's key technologies, the growing role of m
'/>"/>

SOURCE Copenhagen Capacity
Copyright©2007 PR Newswire.
All rights reserved

0

GOOD

Page: 1 2

Related biology technology :

1. The 3rd Annual Burrill Personalized Medicine Meeting November 12-13, 2007 in San Francisco
2. HHS Issues First Department-Wide Report on Personalized Health Care
3. Agendia Joins the Personalized Medicine Coalition (PMC)
4. Elekta Announces New Cancer Care Solutions and Highlights Personalized Efficiency at ASTRO 2007
5. Center for Molecular Medicine Only Regional Provider of Test Suggested in FDA Alert on Prescribing Codeine to Nursing Mothers
6. Systems Medicine (SM), a Subsidiary of Cell Therapeutics, Inc. (CTI), Announces Execution of CRADA with NCI/NIH to Develop Potential Cancer Treatments Targeting the Insulin Growth Factor (IGF) Pathway
7. Pharmion and MethylGene Announce Orphan Drug Designation Granted by the European Medicines Agency (EMEA) for MGCD0103 for the Treatment of Hodgkins Lymphoma
8. Nobel Award in Medicine Holds Strong Messsage for Animal Activists
9. Companys Partner Completes Trial Production of a New Antiviral Medicine
10. Luminex Corporation Reaches Settlement With Rules Based Medicine, Inc.
11. Pioneer in Reproductive Medicine Opens The Countrys First Comprehensive Fertility Practice
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/18/2013)... WILMINGTON, Delaware , June 18, 2013 /PRNewswire/ ... to announce the release of the HELM biomolecular ... permissive open source MIT licence. HELM ... of a wide range of biomolecules (e.g. proteins, ... render existing small-molecule and sequence-based informatics methodologies impractical ...
(Date:6/18/2013)... -- The "Bioinformatics Market By Sector (Molecular Medicine, Agriculture, ... Data Analysis Services) & Application (Genomics, Proteomics & Drug Design) - Global ... Restraints, and Opportunities in North America , ... and Rest of World. Browse , ... Figures 364 Pages and an in-depth ...
(Date:6/18/2013)... , June 18, 2013 ... ) has announced the addition of the ... and Companies " to their offering. ... report briefly reviews basics of human genome ... applications. Current large and small sequencers are ...
(Date:6/18/2013)... DUBLIN , June 18, 2013 ... Markets ( http://www.researchandmarkets.com/research/cmbgcv/north_american ) has announced ... American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes ... Radiation Therapy (I131, Y-90)], [Applications (Cancer/Oncology, ... to 2017" report to their ...
Breaking Biology Technology:The Pistoia Alliance Releases HELM Biomolecular Representation Standard Open Source Tools 2Bioinformatics Market Worth $7.5 Billion by 2017 2Bioinformatics Market Worth $7.5 Billion by 2017 3DNA Sequencing: Technologies, Markets and Companies - 2013 Report 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 3
... that allow nanoparticles to assemble themselves into designer materials ... of Iowa State University and the Ames Laboratory reports ... Science . Travesset, an associate professor of physics ... of Energy,s Ames Laboratory, writes in the journal,s Perspectives ...
... today announced that Jeff Liter has been appointed as ... "Jeff,s diverse background in all aspects of corporate development ... Said Matt McManus, President and CEO, PrimeraDx.  "PrimeraDx,s strategy ... Plex system in the MDx market and define ...
... from the Faculty of Biology and Biotechnology at the ... of Biological Chemistry explaining why enzymes used for ... In collaboration with researchers from Berlin, they used spectroscopic ... that lead to the inactivation of the enzyme,s iron ...
Cached Biology Technology:Iowa State, Ames Lab physicist says nanoparticle assembly is like building with LEGOs 2PrimeraDx Appoints Jeff Liter as VP of Corporate Development 2If oxygen becomes the undoing of proteins 2
(Date:6/18/2013)... Kingdom, the Energy Department,s National Renewable Energy Laboratory ... published a paper describing a novel cellulose-degrading enzyme ... , commonly known as the gribble. , ... relatively unique ability to produce their own enzymes ... the biomass they eat. New biomass-degrading enzymes from ...
(Date:6/18/2013)... not a hacker lab. At Brandeis University, sophisticated ... are helping scientists understand the complex interplay between ... the virus, outer "shell" critical for replication. ... what we are finding will help researchers alter ... post-doctoral fellow Jason Perlmutter, first author of the ...
(Date:6/18/2013)... Torrent, Ph.D., Medical Research Council, Laboratory of Molecular ... a 2013 ICAAC Young Investigator Award. Torrent is ... developing the first algorithm to predict antimicrobial regions ... said, "we are now applying this algorithm to ... antimicrobial peptide leads with very appealing results." ...
Breaking Biology News(10 mins):Novel enzyme from tiny gribble could prove a boon for biofuels research 2Computer modeling technique goes viral at Brandeis 2The American Society for Microbiology honors Marc Torrent 2
... could help ships sailing smoothly. The growth of marine ... major cause of increased energy costs in the naval ... this so called 'bio-fouling'. , Ralph Liedert from the ... work on the application of artificial shark skin in ...
... that provides a vital passage through a bacterium's outer ... is built of the 'wrong' material, scientists at The ... a finding that has long-term implications for understanding diseases ... disease, and mad cow disease. , The paper in ...
... of different items by scanning the tiny barcode printed ... could make it just as easy to identify genes, ... tagging them with color-coded probes made out of synthetic ... Luo, Cornell assistant professor of biological engineering, has created ...
Cached Biology News:Beyond genes: Lipid helps cell wall protein fold into proper shape 2Beyond genes: Lipid helps cell wall protein fold into proper shape 3Tagging pathogens with synthetic DNA 'barcodes' 2Tagging pathogens with synthetic DNA 'barcodes' 3
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... The user-friendly Eppendorf Thermomixer R offers ... that require shaking, heating, and cooling. ... expanded its application and temperature control ... each accommodate 24 micro test tubes, ...
...
Biology Products: