Navigation Links
Cynosure Reports 41% Revenue Increase: 10th Consecutive Quarter of Revenue Growth
Date:4/29/2008

e financial performance, as well as other statements containing the words "believes," "anticipates," "plans," "expects," "will" and similar expressions, constitute forward-looking statements within the meaning of The Private Securities Litigation Reform Act of 1995. Actual results may differ materially from those indicated by such forward-looking statements as a result of various important factors, including Cynosure's history of operating losses, its reliance on sole source suppliers, the inability to accurately predict the timing or outcome of regulatory decisions, changes in consumer preferences, competition in the aesthetic laser industry, economic, market, technological and other factors discussed in Cynosure's most recent Annual Report on Form 10-K, which is filed with the Securities and Exchange Commission. In addition, the forward-looking statements included in this press release represent Cynosure's views as of the date of this press release. Cynosure anticipates that subsequent events and developments will cause its views to change. However, while Cynosure may elect to update these forward- looking statements at some point in the future, it specifically disclaims any obligation to do so. These forward-looking statements should not be relied upon as representing Cynosure's views as of any date subsequent to the date of this press release.

Consolidated Statements of Income

(In thousands, except per share data)

Three Months Ended March 31,

2008 2007

(unaudited)

Revenues $36,763 $26,077

Cost of revenues 12,371 9,922

Gross profit 24,392 16,155

Operating expenses

Selling and marketing
'/>"/>

SOURCE Cynosure, Inc.
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6 7 8 9 10 11

Related biology technology :

1. Cynosure to Present at the Leerink Swann & Company/MEDACorp Aesthetics Roundtable Conference
2. Cynosure to Announce Fourth-Quarter and Full Year 2007 Financial Results on February 12
3. Cynosure Reports Record Revenues and Net Income for the Fourth Quarter of 2007
4. Cynosure Announces Upcoming Investor Presentations at Cowen and Citi Investor Conferences
5. Cynosure Introduces Smartlipo MPX(TM) Dual Wavelength Workstation for LaserBodySculpting(SM)
6. EpiCept Reports Expansion of Clinical Development For Licensed Cancer Compound
7. QMed, Inc. Reports July Medicare SNP Enrollments
8. Phlo Affiliate Reports Expanded Coverage to Oregon Border
9. Healthcare Technologies Reports Loss for 2007 Second Quarter & Six Months Results
10. Dragon Pharmaceutical Reports Growth in Sales and Profits during Second Quarter of 2007
11. Carrington Reports Second Quarter 2007 Results
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:10/22/2014)... and HONG KONG , Oct. ... disease therapeutics enterprise, announced today that rare disease expert ... as vice president, research. Dr. McKew brings more than ... leadership positions at the National Institutes of Health, Wyeth ... by Wyeth). Dr. McKew will lead aTyr,s efforts to expand ...
(Date:10/20/2014)... 20, 2014 /PRNewswire/ - BIOREM Inc. (TSXV: BRM) ("Biorem" or "the ... Q3 orders to $5.8 million and provides a good start to ... North America and one in the ... projects at record levels," said Peter Bruijns , President & ... end of Q3 than they have been for any complete year ...
(Date:10/20/2014)... 20, 2014 Earle Martin ... announced today that Ellen Teplitzky, an experienced attorney ... the pharmaceutical industry, has joined the firm as ... legal services practice. NDA Partners provides legal ... and testimony, to top law firms and their ...
(Date:10/19/2014)... The Asia-Pacific Bromine Market report defines and segments ... forecast of revenue. , Browse through the TOC ... get an idea of the in-depth analysis provided. ... in the Asia-Pacific bromine market, and is supported ... http://www.micromarketmonitor.com/market/asia-pacific-bromine-6741503144.html , Bromine is a volatile and ...
Breaking Biology Technology:aTyr Pharma Appoints John C. McKew, Ph.D., as Vice President, Research 2aTyr Pharma Appoints John C. McKew, Ph.D., as Vice President, Research 3NDA Partners Appoints Ellen Teplitzky, JD as Director of its Legal Services Practice 2The Asia-Pacific Bromine Market is estimated to grow to $4,080.1 million by 2018 - New Report by MicroMarket Monitor 2The Asia-Pacific Bromine Market is estimated to grow to $4,080.1 million by 2018 - New Report by MicroMarket Monitor 3
... N.Y., Nov. 5 BioSpecifics Technologies Corp. (Nasdaq: ... today announced its financial results for the third quarter ... happy that, in September of this year, the FDA,s ... 12-0, the approval of XIAFLEX(TM) for the treatment of ...
... November 5, 2009 Senomyx, Inc. (Nasdaq: SNMX ), ... discover novel flavor ingredients for the food, beverage, and ingredient ... results for the third quarter ended September 30, 2009. ... compared to $4.0 million for the third quarter of 2008, ...
... PLYMOUTH MEETING, Pa., Nov. 5 /PRNewswire-Asia-FirstCall/ -- BMP Sunstone,Corporation (Nasdaq: ... the Company plans to release third quarter 2009 financial results ... The Company will hold a conference call ... quarter 2009 results. Listeners may access the call by,dialing ...
Cached Biology Technology:BioSpecifics Technologies Corp. Reports Third Quarter 2009 Financial Results 2BioSpecifics Technologies Corp. Reports Third Quarter 2009 Financial Results 3BioSpecifics Technologies Corp. Reports Third Quarter 2009 Financial Results 4BioSpecifics Technologies Corp. Reports Third Quarter 2009 Financial Results 5SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 2SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 3SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 4SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 5SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 6SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 7SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 8SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 9SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 10SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 11SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 12SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 13SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 14BMP Sunstone to Report Third Quarter 2009 Financial Results 2
(Date:10/15/2014)... our ability to assess the pandemic risk from strains ... we must not allow ourselves to become complacent that ... international consortium of scientists. , Influenza pandemics arise when ... yet to develop widespread immunity – spreads in the ... the past 100 years, the worst of which – ...
(Date:10/15/2014)... an unexpected extent. The outbreak does not follow the ... a new disease dynamic in regions, where it has ... National Academy of Sciences Leopoldina, acatech – the German ... the German Academies of Sciences and Humanities have presented ... the statement the academies call for the following consequences ...
(Date:10/15/2014)... the 44th Rosenstiel Award for Distinguished Work in Biomedical ... the mechanisms of genomic instability and its implications for ... second alumnus to win the Rosenstiel Award; the first, ... Alt is the Charles A. Janeway Professor of Pediatrics ... an investigator at the Howard Hughes Medical Institute at ...
Breaking Biology News(10 mins):Scientists 'must not become complacent' when assessing pandemic threat from flu viruses 2Academies call for consequences from the Ebola virus epidemic 2Academies call for consequences from the Ebola virus epidemic 3Academies call for consequences from the Ebola virus epidemic 4Academies call for consequences from the Ebola virus epidemic 5Brandeis awards 44th Rosenstiel Award to pioneering geneticist Fred Alt 2
... in Spanish . An Agricultural Research ... other insects over vast acreage so their movements can be ... affordable. That,s according to recently published research by ... Research Center in Maricopa, Ariz., and his collaborators at the ...
... Plants and people alike face critical choices as ... seedsor babies--or many small, poorly-provisioned ones. Different species ... diversity of life forms: Darwin,s "endless forms most ... at the Smithsonian Tropical Research Institute argues that ...
... WI, February 15, 2010 -- Agricultural nonpoint source ... leading sources of pollution in rivers and water ... are making concerted efforts to reduce these pollutions ... As promising and effective BMPs, vegetated buffers are ...
Cached Biology News:New assay helps track termites and other insects 2Stress and trade-offs explain life's diversity: New Smithsonian model 2A review of vegetated buffer efficacy 2
Mouse monoclonal antibody raised against a full length recombinant SLC25A11. NCBI Entrez Gene ID = SLC25A11...
Mouse polyclonal antibody raised against a partial recombinant SYT4. NCBI Entrez Gene ID = 6860...
Agarose II (Low Melt)...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
Biology Products: