Navigation Links
Corium International, Inc. Announces Appointment of Phyllis Gardner, M.D. and Daniel G. Welch to Board
Date:11/27/2007

MENLO PARK, Calif., Nov. 27 /PRNewswire/ -- Corium International, Inc., a privately-held transdermal drug delivery company, today announced the appointment of Phyllis Gardner, M.D. and Daniel G. Welch to the Board of Directors. Dr. Gardner, an adjunct partner at Essex Woodlands Health Ventures, is a Professor of Medicine at Stanford University and widely published in the fields of cell biology and pharmacology. In addition to her academic work, Dr. Gardner has been active in the biotechnology and pharmaceutical industries. In 1996, she took a leave of absence from Stanford and joined ALZA Corporation as a Principal Scientist, Vice President of Research, and Head of the ALZA Technology Institute. Dr. Gardner is the co-founder of Genomics Collaborative, Inc. (now a division of Bioserve), SKOLAR MD (acquired by Wolters Klure) and APEX DX, LLC. She currently serves on the boards of Ventaira Pharmaceuticals, UMD, Inc., and Revance, Inc., and she is on the Scientific Advisory Board of Aradigm Corp. Dr. Gardner received her M.D. from Harvard Medical School, and received postgraduate training at Massachusetts General Hospital, Stanford School of Medicine, Columbia University and University College London.

Daniel G. Welch has served as Chief Executive Officer and President of InterMune since September 2003. Prior to InterMune, Mr. Welch was Chairman and CEO of Triangle Pharmaceuticals, a biopharmaceutical company, which was acquired by Gilead. From 2000 to 2002, he was President of Biopharmaceuticals at Elan Corporation where he was responsible for U.S. commercial operations, the international subsidiaries, the R&D function and the diagnostics businesses. Mr. Welch served in several senior management roles at Sanofi-Aventis during the years 1987 to 2000, including Vice President of Worldwide Marketing and COO of the U.S. business. Prior to joining Sanofi-Aventis, Mr. Welch was with American Critical Care, a division of American Hospital Supply. Mr. Welch is a m
'/>"/>

SOURCE Corium International, Inc.
Copyright©2007 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Corium International, Inc., Announces $40 Million Financing led by Essex Woodlands Health Ventures
2. JPMorgans Principal Investment Management Group to Invest in Chindex International, Inc.
3. Dendreon Announces Publication of Phase 1 Study Highlighting Immunologic and Clinical Activity of Lapuleucel-T (Neuvenge(R)) in Advanced Breast Cancer Patients
4. YM BIOSCIENCES ANNOUNCES COMPLIANCE WITH AIM RULE 26
5. Emisphere Technologies, Inc. Announces Pricing of Registered Direct Offering
6. BioLife Solutions Announces Exclusive CryoStor(TM) Supply Agreement With the New England Cryogenic Center, Inc.
7. Carrington Announces Nasdaq Communication; Prepares for Shares to Be Quoted on the OTC Bulletin Board and Pink Sheets
8. China Kangtai Cactus Biotech Files 2nd Quarter 2007 10QSB and Announces Unaudited Quarterly Results
9. Cephalon Announces Positive Results from a Pivotal Study of FENTORA in Opioid-tolerant Patients with Non-cancer Breakthrough Pain
10. Advanced Life Sciences Announces Receipt of Nasdaq Staff Letter
11. ADVENTRX Announces Fast Track Designation Granted By the FDA For CoFactor For the Treatment of Metastatic Colorectal Cancer
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/18/2013)... WILMINGTON, Delaware , June 18, 2013 /PRNewswire/ ... to announce the release of the HELM biomolecular ... permissive open source MIT licence. HELM ... of a wide range of biomolecules (e.g. proteins, ... render existing small-molecule and sequence-based informatics methodologies impractical ...
(Date:6/18/2013)... -- The "Bioinformatics Market By Sector (Molecular Medicine, Agriculture, ... Data Analysis Services) & Application (Genomics, Proteomics & Drug Design) - Global ... Restraints, and Opportunities in North America , ... and Rest of World. Browse , ... Figures 364 Pages and an in-depth ...
(Date:6/18/2013)... , June 18, 2013 ... ) has announced the addition of the ... and Companies " to their offering. ... report briefly reviews basics of human genome ... applications. Current large and small sequencers are ...
(Date:6/18/2013)... DUBLIN , June 18, 2013 ... Markets ( http://www.researchandmarkets.com/research/cmbgcv/north_american ) has announced ... American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes ... Radiation Therapy (I131, Y-90)], [Applications (Cancer/Oncology, ... to 2017" report to their ...
Breaking Biology Technology:The Pistoia Alliance Releases HELM Biomolecular Representation Standard Open Source Tools 2Bioinformatics Market Worth $7.5 Billion by 2017 2Bioinformatics Market Worth $7.5 Billion by 2017 3DNA Sequencing: Technologies, Markets and Companies - 2013 Report 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 3
... that allow nanoparticles to assemble themselves into designer materials ... of Iowa State University and the Ames Laboratory reports ... Science . Travesset, an associate professor of physics ... of Energy,s Ames Laboratory, writes in the journal,s Perspectives ...
... today announced that Jeff Liter has been appointed as ... "Jeff,s diverse background in all aspects of corporate development ... Said Matt McManus, President and CEO, PrimeraDx.  "PrimeraDx,s strategy ... Plex system in the MDx market and define ...
... from the Faculty of Biology and Biotechnology at the ... of Biological Chemistry explaining why enzymes used for ... In collaboration with researchers from Berlin, they used spectroscopic ... that lead to the inactivation of the enzyme,s iron ...
Cached Biology Technology:Iowa State, Ames Lab physicist says nanoparticle assembly is like building with LEGOs 2PrimeraDx Appoints Jeff Liter as VP of Corporate Development 2If oxygen becomes the undoing of proteins 2
(Date:6/18/2013)... Kingdom, the Energy Department,s National Renewable Energy Laboratory ... published a paper describing a novel cellulose-degrading enzyme ... , commonly known as the gribble. , ... relatively unique ability to produce their own enzymes ... the biomass they eat. New biomass-degrading enzymes from ...
(Date:6/18/2013)... not a hacker lab. At Brandeis University, sophisticated ... are helping scientists understand the complex interplay between ... the virus, outer "shell" critical for replication. ... what we are finding will help researchers alter ... post-doctoral fellow Jason Perlmutter, first author of the ...
(Date:6/18/2013)... Torrent, Ph.D., Medical Research Council, Laboratory of Molecular ... a 2013 ICAAC Young Investigator Award. Torrent is ... developing the first algorithm to predict antimicrobial regions ... said, "we are now applying this algorithm to ... antimicrobial peptide leads with very appealing results." ...
Breaking Biology News(10 mins):Novel enzyme from tiny gribble could prove a boon for biofuels research 2Computer modeling technique goes viral at Brandeis 2The American Society for Microbiology honors Marc Torrent 2
... could help ships sailing smoothly. The growth of marine ... major cause of increased energy costs in the naval ... this so called 'bio-fouling'. , Ralph Liedert from the ... work on the application of artificial shark skin in ...
... that provides a vital passage through a bacterium's outer ... is built of the 'wrong' material, scientists at The ... a finding that has long-term implications for understanding diseases ... disease, and mad cow disease. , The paper in ...
... of different items by scanning the tiny barcode printed ... could make it just as easy to identify genes, ... tagging them with color-coded probes made out of synthetic ... Luo, Cornell assistant professor of biological engineering, has created ...
Cached Biology News:Beyond genes: Lipid helps cell wall protein fold into proper shape 2Beyond genes: Lipid helps cell wall protein fold into proper shape 3Tagging pathogens with synthetic DNA 'barcodes' 2Tagging pathogens with synthetic DNA 'barcodes' 3
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... The user-friendly Eppendorf Thermomixer R offers ... that require shaking, heating, and cooling. ... expanded its application and temperature control ... each accommodate 24 micro test tubes, ...
...
Biology Products: