Navigation Links
Cord Blood America Says Pennsylvania Joins New York and California in Establishing Educational Programs on the Benefits of Umbilical Cord Blood Storage
Date:4/11/2008

LOS ANGELES, April 11 /PRNewswire-FirstCall/ -- Cord Blood America, Inc. (OTC Bulletin Board: CBAI), the umbilical cord blood stem cell preservation company (http://www.cordblood-america.com) focused on bringing the life saving potential of stem cells to families nationwide and internationally, today said Pennsylvania has joined New York and California in passing a law designed to educate pregnant women about the potential benefits of umbilical cord blood banking. The bill was signed by Governor Edward G. Rendell.

Cord Blood America, in its acquisition of CorCell, has strong relationships in both Philadelphia and Pittsburgh with health insurers and the medical community. CorCell's sales and marketing are based in Philadelphia.

"It is so important that families be informed about the benefits of umbilical cord blood storage, which is safe, non-controversial and is already used to treat more than 70 serious diseases, including various blood cancers such as leukemia, lymphoma and myelomas such as Hodgkin's Disease, and blood diseases including anemia and immune deficient disorders," said Matthew Schissler, CEO, Cord Blood America.

"We salute Pennsylvania for joining New York and California in taking the lead in providing solid, reliable information to potential new parents and believe this trend will continue in many more states," Mr. Schissler said.

About Cord Blood America

Cord Blood America (OTC Bulletin Board: CBAI) is the parent company of CorCell, which facilitates umbilical cord blood stem cell preservation for expectant parents and their children. Its mission is to be the most respected stem cell preservation company in the industry. Collected through a safe and non-invasive process, cord blood stem cells offer a powerful and potentially life-saving resource for treating a growing number of ailments, including cancer, leukemia, blood, and immune disorders. To f
'/>"/>

SOURCE Cord Blood America, Inc.
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2

Related biology technology :

1. CSL Behring Signs Agreements With Canadian Blood Services and Hema-Quebec to Supply Life-Saving Therapies
2. Significant Reductions in Mortality and Cardiovascular Events Shown Using Blood Pressure-Lowering Treatment in Those Aged 80 and Over
3. Device That Clears Debris From Artery Aids Blood Flow in PCI
4. 960-Patient Study Demonstrates Zero Blood Stream Infection In Patients Treated With Angiotechs Novel 5-FU Central Venous Catheter
5. Cord Blood America Subsidiary Featured at NASCAR Sprint Cup Series Race
6. Publication in Clinical Cancer Research Confirms Ability of Peregrines Bavituximab to Target Tumor Blood Vessels with Excellent Specificity
7. Quest Diagnostics to Develop Blood Test to Aid in the Detection of Colorectal Cancer
8. FREE Infant CPR Training and Cord Blood Banking 101 for Expectant Parents
9. Two-time Defending NASCAR Sprint Cup Series Champion Jimmie Johnson Joins the Team at CORD:USE Cord Blood Bank to Help Win the Race for Life
10. Cord Blood America CEO Matthew Schissler Interviewed by BIONOVA, Greeces Leading Biotech Magazine
11. CORD:USE Cord Blood Bank Announces the Addition of Dr. John Wagner, a Pioneer in the Use of Umbilical Cord Blood Stem Cells, to Its Scientific Advisory Board
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:7/2/2015)... 2, 2015  Spherix Incorporated (Nasdaq: SPEX ) -- an ... monetization of intellectual property, today announced a litigation update. ... v. Verizon Services Corp. et al. , Case No. ... Eastern District of Virginia , the ... interpreting certain key claims in favor of the Defendants ...
(Date:7/1/2015)... ... July 01, 2015 , ... It is now possible ... using single photon emission computed tomography (SPECT) according to researchers from Amen ... examined over 20,000 brain scans and is believed to be the largest brain imaging ...
(Date:7/1/2015)... AURORA, Colo. and BANGALORE, India ... a global genomic profiling company that uses next generation ... appointment of Scott A. Storrer as chief ... and CEO, he will be responsible for all strategy, ... Vijay Chandru , who has served as Strand,s chairman ...
(Date:7/1/2015)... ... July 01, 2015 , ... A newly launched business plan contest ... the barriers to innovation in life sciences R&D. The Pistoia Alliance President’s Startup Challenge ... of US$15,000 and a period of expert mentorship from a senior industry figure drawn ...
Breaking Biology Technology:Spherix Issues A Litigation Update 2Spherix Issues A Litigation Update 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 2Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 4Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 2Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 3Pistoia Alliance Launches Startup Challenge 2Pistoia Alliance Launches Startup Challenge 3
... Portfolio of Transfusion Solutions Offers Choice, ... Opportunity for Blood Bank Industry, ROCKAWAY, ... subsidiary of German-based Biotest AG, a worldwide,supplier of traditional and ... clearance from the U.S. Food and Drug,Administration (FDA) to begin ...
... Historic First Loss on Custom Medical Devices, SOUTH ... by Endotec, Inc. -- Vincent J. Capricci, 56, is ... district, and an avid,hunter, golfer and fisherman. After minor ... infection which destroyed his ankle joint.,He was out of ...
... its revolutionary Trusted LASIK Eye Surgeons directory service ... . What sets the Trusted LASIK Surgeons directory ... only the best LASIK Surgeons in the United ... LASIK Surgeon Dr. R. Wayne Bowman, are screened ...
Cached Biology Technology:Biotest Diagnostics Receives FDA Clearance for Full Line of Traditional Blood Bank Reagents 2Biotest Diagnostics Receives FDA Clearance for Full Line of Traditional Blood Bank Reagents 3FDA Gets Knocked Out in Endotec, Inc. Ruling 2FDA Gets Knocked Out in Endotec, Inc. Ruling 3Trusted LASIK Surgeons Welcomes Dallas LASIK Eye Surgery Specialist Dr. R. Wayne Bowman to its LASIK Directory 2Trusted LASIK Surgeons Welcomes Dallas LASIK Eye Surgery Specialist Dr. R. Wayne Bowman to its LASIK Directory 3Trusted LASIK Surgeons Welcomes Dallas LASIK Eye Surgery Specialist Dr. R. Wayne Bowman to its LASIK Directory 4Trusted LASIK Surgeons Welcomes Dallas LASIK Eye Surgery Specialist Dr. R. Wayne Bowman to its LASIK Directory 5Trusted LASIK Surgeons Welcomes Dallas LASIK Eye Surgery Specialist Dr. R. Wayne Bowman to its LASIK Directory 6
(Date:7/2/2015)... -- Fingerprint Cards has received an order for ... the distributor World Peace Industrial Group (WPI), part of WPG ... Asia . Deliveries are planned to take place during ... smartphone manufacturers in Asia . The order ... guidance of approximately 2,200 MSEK for 2015. Jörgen ...
(Date:6/25/2015)... June 25, 2015 According ... Type (Swipe & Area), Technology, Material (Optical Prism, ... Commercial Security & Others) & Geography - Global ... the said market is expected to reach $14,500.07 ... Browse 76 market Tables and ...
(Date:6/24/2015)... 24, 2015  Synaptics Inc. (NASDAQ: SYNA ... today announced that Sharp has selected its industry-leading ... for its latest flagship smartphone device, the AQUOS ... million shipments of its fingerprint ID sensor technology, ... scalability and leadership in the biometrics market through ...
Breaking Biology News(10 mins):FPC Receives Order for Touch Fingerprint Sensors of 268 MSEK 2Fingerprint Sensors Market Worth $14,500.07 Million by 2020 2Fingerprint Sensors Market Worth $14,500.07 Million by 2020 3Fingerprint Sensors Market Worth $14,500.07 Million by 2020 4Synaptics Brings Natural ID Technology to Sharp's Newest Flagship Smartphone 2
... discovery of the first new living species of giant clam ... online on August 28th in Current Biology , a ... species, called Tridacna costata , once accounted for more ... it now represents less than one percent of giant clams ...
... 27, 2008 What happens when linguistic tools used ... between a language-competent bonobo and a human? The findings, ... Psychological and Behavioral Science , indicate that bonobos may ... controlled experimental settings. The peer-reviewed paper was written ...
... advantage of using two eyes to see the world around ... see in 3-D. Now, a new study from a scientist ... to binocular vision: our ability to see through things. ... for example exist in non-cluttered environments like fields or ...
Cached Biology News:New giant clam species offers window into human past 2Great Ape Trust graduate student's paper sheds light on bonobo language 2Great Ape Trust graduate student's paper sheds light on bonobo language 3Great Ape Trust graduate student's paper sheds light on bonobo language 4Study says eyes evolved for X-Ray vision 2Study says eyes evolved for X-Ray vision 3
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Biology Products: