Navigation Links
Clearing the air: PNNL technology wins award for improving submarine air quality
Date:5/4/2012

RICHLAND, Wash. Creators of a nanotech-based system that captures carbon dioxide directly from the atmosphere within a submarine, while providing a more environmentally friendly removal process, have won the Federal Laboratory Consortium Interagency Partnership Award for 2012. The technology Self Assembled Monolayers on Mesoporous Supports, or SAMMS is destined for incorporation into future submarines to improve air quality for sailors who serve on them.

The FLC's Interagency Partnership Award annually recognizes employees from at least two different federal agencies or laboratories who have "collaboratively accomplished outstanding work in transferring a technology." The IPA acknowledges the collaborative relationship among the Department of Energy's Pacific Northwest National Laboratory, the U.S. Naval Surface Warfare Center Carderock Division, Ship Systems Engineering Station and the U.S. Naval Sea Systems Command.

The Navy continually seeks technology to improve processes and conditions for the thousands of sailors serving onboard its current fleet of submarines. This approach is an entirely new application developed to cleanse breathing air in the confined space of a submarine. The system demonstrated that it can replace a bulky, heavy, corrosive and malodorous liquid process that produces a significant organic solvent waste stream used for more than half of a century by the U.S. Navy and navies of many other countries.

"This is a new application of a technology that was previously developed by PNNL to remove heavy metal contamination from ground and surface waters found at many DOE waste sites," said PNNL Material Scientist Glen Fryxell, one of the key PNNL inventors of the SAMMS technology. The SAMMS materials can absorb large quantities of liquid and airborne contaminants without creating secondary waste, and is disposable as nonhazardous waste.

The SAMMS technology is based on a new class of hybrid nanoporous mate
'/>"/>

Contact: Geoffrey Harvey
geoffrey.harvey@pnnl.gov
509-372-6083
DOE/Pacific Northwest National Laboratory
Source:Eurekalert

Page: 1 2

Related biology technology :

1. GeneWize Announces New Skin Clearing Product and Teen Nutrition at Annual Convention
2. InNexus Biotechnology Announces Launch of Large Scale Primate Study of DXL625
3. CardioWest™ Artificial Heart Approved For Highest Reimbursement in CMS History : Plus Up To $53,000 New Technology Add-on Payments
4. Yongye Biotechnology International Retains CCG Investor Relations
5. William F. Prendergast Named One of the Top IP Lawyers in Nanotechnology
6. John Grisham Joins Focused Ultrasound Surgery Foundation Board, Citing Novel Technologys Potential to Help Millions of Patients
7. Yongye Biotechnology International Announces Conference Call to Discuss Second Quarter 2008 Results
8. [video] Jacques Tizabi, CEO of Universal Detection Technology Discusses Latest Purchase Order on WallSt.nets 3-Minute Press Show
9. Yongye Biotechnology International Announces Second Quarter Results
10. BeaconEquity.com Issues Trade Alerts on Biotechnology Stocks: ELN, PFE, AMGN, DNA, BIIB, GILD
11. ArunA Biomedical Announces Exclusive Worldwide Technology Licensing Agreement to Commercialize Human Embryonic Stem Cell Derived Mesenchymal Cells
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/18/2013)... 2013) A million electric cars could be on roads ... the help of research by the United States Department of ... , Professor Zhongwei Chen is part of a team led ... materials to replace the expensive platinum catalysts in fuel cells. ... fuel cells in vehicles is the cost of the units. ...
(Date:6/18/2013)... York, NY (PRWEB) June 18, 2013 ... innovation and sustainability, the Consulate General of Switzerland in ... solar boat, Switzerland’s MS Tûranor PlanetSolar , to ... part of its DeepWater Expedition 2013 tour with scientists ... led by Capitain Gérard d’Aboville, runs exclusively on energy ...
(Date:6/18/2013)... The Regulatory Affairs Professionals Society ... in Asia—one in Singapore and one in Shanghai, China. ... Pan-Asia office , serving the Asia Pacific region, and ... within China. , The announcement comes just a few ... government agencies to develop and implement a new ...
(Date:6/18/2013)... The human skin is the largest organ, ... human body part. Similar to the liver, or heart, the ... repair and grow. Recent reports from the mankatofreepress.com explained how ... as important as other life supporting organs. The article suggests ... cell reproduction, increase the appearance of skin, and fight off ...
Breaking Biology Technology:US and Canadian researchers drive towards cheaper fuel cells for electric cars 2Switzerland’s MS Tûranor PlanetSolar, the World’s Largest Solar Boat, Arrives in New York City 2Switzerland’s MS Tûranor PlanetSolar, the World’s Largest Solar Boat, Arrives in New York City 3Switzerland’s MS Tûranor PlanetSolar, the World’s Largest Solar Boat, Arrives in New York City 4RAPS Opens Offices in Singapore and China 2RAPS Opens Offices in Singapore and China 3Natural Acne Remedies Through Diet, Probiotic Action Shares New Insight on What Foods May Help Lead to Clear Skin 2
... Cynosure, Inc.,(Nasdaq: CYNO ), a leading ... aesthetic treatment systems, today announced that the company,will ... call on Tuesday,February 12, 2008 at 9:00 a.m. ... Executive Officer Michael Davin and,Executive Vice President and ...
... Introduced at Informex 2008, REDWOOD CITY, Calif., ... and leading developer of clean manufacturing,processes, today introduced ... can be used by pharmaceutical companies to more,rapidly ... lead,candidates., The Codex(TM) MicroCyp Plate is being ...
... Phase 1 studies show sobetirome, a selective thyroid hormone ... ... versus placebo, ANN ARBOR, Mich., Jan. 29 QuatRx ... endocrine, metabolic and cardiovascular diseases, today,announced results from two Phase ...
Cached Biology Technology:Cynosure to Announce Fourth-Quarter and Full Year 2007 Financial Results on February 12 2Codexis Launches Codex(TM) MicroCyp Platform to Produce Drug Metabolites and Novel Lead Compounds 2Phase 1 Studies Show Promise of QuatRx's Novel Compound, Sobetirome, for Lowering LDL Cholesterol Levels 2Phase 1 Studies Show Promise of QuatRx's Novel Compound, Sobetirome, for Lowering LDL Cholesterol Levels 3
(Date:6/17/2013)... bacteria, and algae, is a common component of sugar-free ... the medical field it,s approved by the FDA ... used during surgery as a substance that opens the ... , Now Profs. Ehud Gazit and Daniel Segal of ... and the Sagol School of Neuroscience, along with their ...
(Date:6/17/2013)... Ore. Amphibian populations are declining worldwide and a ... spread by bullfrogs, but a two-year study shows they ... that bullfrogs are a tolerant carrier host that just ... from eggs in controlled experimental conditions, they found at ... , also called Bd or a chytrid fungus, can ...
(Date:6/16/2013)... were fed a high-fat diet and became obese were ... levels of body fat, a new Ohio University study ... offspring, despite their consumption of a low-fat diet, scientists ... Society in San Francisco, Calif. , "We,ve identified a ... of offspring dependent on the pre-conception diet of the ...
Breaking Biology News(10 mins):Artificial sweetener a potential treatment for Parkinson's disease 2Bullfrogs may help spread deadly amphibian fungus, but also die from it 2Obese male mice father offspring with higher levels of body fat 2
... Saturday 02 April 2011: Data presented at the ... novel antiviral compounds for the treatment of hepatitis ... by experts and specialists to ensure resistance is ... of HCV resistance in patients treated with NS3-protease, ...
... (NASDAQ: AWRE ), a leading supplier of technology ... that Edmund C. Reiter has resigned, effective April 1, 2011, ... board of the company citing personal reasons.   ... have been named co-CEOs and co-Presidents on an interim basis. ...
... huge demands on water resources around the globe. ... major contributor to the nation,s economy, 85% of ... sector. The excessive use of irrigation water has ... where rising demand has deteriorated groundwater resources, depleted ...
Cached Biology News:Data suggest liver experts should take care when prescribing novel antiviral HCV drugs 2Aware, Inc. Announces Resignation of Chief Executive Officer 2Aware, Inc. Announces Resignation of Chief Executive Officer 3Research on satellite imagery aims to advance sustainable agriculture 2
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... The user-friendly Eppendorf Thermomixer R offers ... that require shaking, heating, and cooling. ... expanded its application and temperature control ... each accommodate 24 micro test tubes, ...
...
Biology Products: