Navigation Links
China Sky One Medical Announces Preliminary First Quarter 2010 Results; Reschedules Earnings Conference Call
Date:5/10/2010

nts, partly offset by approximately $1.3 million of previously recorded liability in connection with a registration rights obligation related to the Warrants.

"We are working expeditiously with our auditor and counsel to complete the analysis and file the 10-Q and amended 10-K as soon as practical. We appreciate your continued support of the Company and apologize for the inconvenience of delaying our first quarter 2010 results. We look forward to sharing our operational updates and R&D pipeline progress on the earnings call," concluded Mr. Liu.

About China Sky One Medical, Inc.

China Sky One Medical, Inc., a Nevada corporation, is a holding company. The Company engages in the manufacturing, marketing and distribution of pharmaceutical, medicinal and diagnostic products. Through its wholly-owned subsidiaries, Harbin Tian Di Ren Medical Science and Technology Company ("TDR"), Harbin First Bio-Engineering Company Limited ("First"), Heilongjiang Tianlong Pharmaceutical, Inc. ("Tianlong") and Peng Lai Jin Chuang Pharmaceutical Company ("Jin Chuang") the Company manufactures and distributes over-the-counter pharmaceutical products, which make up its major revenue source. For more information, visit http://www.cski.com.cn .

Safe Harbor Statement

Certain of the statements made in the press release constitute forward- looking statements within the meaning of the Private Securities Litigation Reform Act of 1995. These statements can be identified by the use of forward- looking terminology such as "believe," "expect,"
'/>"/>

SOURCE China Sky One Medical, Inc.
Copyright©2010 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6

Related biology technology :

1. China Kangtai Cactus Biotech Files 2nd Quarter 2007 10QSB and Announces Unaudited Quarterly Results
2. China Biopharmaceuticals Holdings Announces Second Quarter 2007 Financial Results
3. China Medical Technologies to Participate in the Morgan Stanleys 2007 China Medical Corporate Day
4. China-Biotics, Inc. Signs Intention Agreement to Supply Probiotics to Bright Dairy & Food Co., Ltd.
5. China Technology Announces New Chief Financial Officer
6. China Medical Technologies Reports First Quarter Financial Results
7. China Medical Technologies to Participate in Credit Suisses 2007 Asian Technology Conference
8. China Technology Announces Entry to the Solar Energy Sector
9. China Sky One Medical Receives $1.5 Million Government Grant to Further Develop Six New Cancer Products
10. Kiwa Bio-Tech Named Recommended Brand by the China Green Food Association
11. China Kangtai Cactus Biotech, Inc. Announces Plans for New Product Launch
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/19/2014)... San Diego, CA (PRWEB) December 18, 2014 ... announces a limited time special on Sartorius Biohit ... 1 Free on mLINE pipettes, Picus Electronic Pipette Trade-in ... recommended by Health and Safety officers around the world. ... repetitive manual pipetting. Other features include:, , ...
(Date:12/19/2014)... 18, 2014   ISN has released its ... Indicators publication series. With data aggregated from ... in 2013 within its online contractor management platform, ISNetworld, ... performance indicator (KPI) statistics. The ... publication is available in two industry specific volumes: ...
(Date:12/17/2014)... Based on the revenues gained ... market is dominated by four major players contributing ... These players include GE Healthcare (U.K.), Siemens AG ... , Full Report Copy at http://www.marketsandmarkets.com/Market-Reports/surgical-imaging-market-210534462.html ... be attributed to its strong product portfolio, which ...
(Date:12/17/2014)... BASKING RIDGE, N.J. (PRWEB) December 17, 2014 ... Ipsen (Euronext: IPN; ADR: IPSEY), ... 120 mg (referred to as Somatuline®) was approved ... for the treatment of gastroenteropancreatic neuroendocrine tumors (GEP-NETs) ... differentiated, locally advanced or metastatic disease to improve ...
Breaking Biology Technology:Major Pipette Distributor Pipette.com Announces Sartorius Year End Specials 2ISN Releases Third Edition of US Contractor Health & Safety Performance Indicators Publication Series 2ISN Releases Third Edition of US Contractor Health & Safety Performance Indicators Publication Series 3Global Refurbished Surgical Imaging Market by Product & Application is Estimated to Reach $1.25 Billion by 2019 - New Research Report by MarketsandMarkets 2Global Refurbished Surgical Imaging Market by Product & Application is Estimated to Reach $1.25 Billion by 2019 - New Research Report by MarketsandMarkets 3Global Refurbished Surgical Imaging Market by Product & Application is Estimated to Reach $1.25 Billion by 2019 - New Research Report by MarketsandMarkets 4Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 2Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 3Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 4Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 5Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 6Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 7Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 8
... 2011 Verenium Corporation (Nasdaq: VRNM ), ... industrial enzyme solutions, today announced that James Levine, Executive ... the upcoming Piper Jaffray Sixth Annual Clean Technology & ... 3:00 p.m. EST on Wednesday, January 12, 2011 and ...
... , WEST LAFAYETTE, Ind. - Researchers are creating a ... natural photosynthetic systems in plants by using carbon nanotubes ... and reducing cost. "We,ve created artificial photosystems using ... to electrical power," said Jong Hyun Choi, an assistant ...
... and BUDAPEST, Hungary, Jan. 4, 2011 The IP ... property research and analysis solutions, and ChemAxon, the leader ... announced a strategic partnership whereby Thomson Reuters is providing ... patent data to users of ChemAxon,s JChem chemical software ...
Cached Biology Technology:Verenium to Present at Piper Jaffray Sixth Annual Clean Technology & Renewables Conference 2Verenium to Present at Piper Jaffray Sixth Annual Clean Technology & Renewables Conference 3New solar cell self-repairs like natural plant systems 2Thomson Reuters and ChemAxon Partner to Help Speed Drug Discovery for Life Science Researchers 2Thomson Reuters and ChemAxon Partner to Help Speed Drug Discovery for Life Science Researchers 3
(Date:12/11/2014)... 2014  Data Sciences International (DSI), the global ... new series of digital telemetry implants to meet ... series, part of the PhysioTel™ Digital platform, was ... physiologic data when incorporating functional endpoints into repeat-dose ... toxicology studies has evolved from short ECG strips ...
(Date:12/10/2014)... DIEGO , Dec. 9, 2014 CIE ... collaboration catalyst that provides the connective tissue that enhances ... enabling them to easily share client-level information; earned a ... to expand to organizations serving seniors aging in community ... Diego" partner on December 11 th 4-6p. ...
(Date:12/5/2014)... , Dec. 4, 2014  Tute Genomics, a leader ... million in Series A1 funding led by UK-based Eurovestech. ... participated in the investment round. "We are ... community adopts next-generation sequencing and seeks new approaches for ... Reid Robison , MD MBA, and CEO of Tute ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... a soil science professor at the University of Guam, has ... use in shielding the reefs in Pago Bay from the ... major health hazards facing Guam,s reefs is soil erosion resulting ... up a reef system. "Vetiver,s ability to tolerate high stress ...
... fog, tennis shoes, chocolate mousse, and proteins have something in ... of research that explains the behavior of a wide variety ... and a number of biological materials. In the ... made of (Springer), Roberto Piazza, professor of condensed matter physics, ...
... in their personal and professional lives, University of ... gain greater control over their thoughts with real-time ... first investigation of how real-time functional Magnetic Resonance ... for higher-order thoughts, including introspection, affects our ability ...
Cached Biology News:Bioengineering with vetiver grass on Guam 2Soft matter -- the stuff that dreams are made of 2People control thoughts better when they see their brain activity: UBC study 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: