Navigation Links
China Biologic's Production Facility Renews GMP Certification

ements are reasonable, they do involve assumptions, risks and uncertainties, and these expectations may prove to be incorrect. Investors should not place undue reliance on these forward-looking statements, which speak only as of the date of this press release. The Company's actual results could differ materially from those anticipated in these forward-looking statements as a result of a variety of factors, including those discussed in the Company's periodic reports that are filed with the Securities and Exchange Commission and available on its website ( ). All forward-looking statements attributable to the Company or persons acting on its behalf are expressly qualified in their entirety by these factors. Other than as required under the securities laws, the Company does not assume a duty to update these forward-looking statements.

For more information, please contact:

Company Contact:

Mr. Y. Tristan Kuo


China Biologic Products, Inc.

Tel: +86-538-6202206



Investor Relations Contact:

Mr. Crocker Coulson


CCG Investor Relations

Tel: +1-646-213-1915 (NY office)



SOURCE China Biologic Products, Inc.
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. China Kangtai Cactus Biotech Files 2nd Quarter 2007 10QSB and Announces Unaudited Quarterly Results
2. China Biopharmaceuticals Holdings Announces Second Quarter 2007 Financial Results
3. China Medical Technologies to Participate in the Morgan Stanleys 2007 China Medical Corporate Day
4. China-Biotics, Inc. Signs Intention Agreement to Supply Probiotics to Bright Dairy & Food Co., Ltd.
5. China Technology Announces New Chief Financial Officer
6. China Medical Technologies Reports First Quarter Financial Results
7. China Medical Technologies to Participate in Credit Suisses 2007 Asian Technology Conference
8. China Technology Announces Entry to the Solar Energy Sector
9. China Sky One Medical Receives $1.5 Million Government Grant to Further Develop Six New Cancer Products
10. Kiwa Bio-Tech Named Recommended Brand by the China Green Food Association
11. China Kangtai Cactus Biotech, Inc. Announces Plans for New Product Launch
Post Your Comments:
(Date:9/23/2014)... 23, 2014 Texas Fertility Center (TFC) ... South Austin, expanding a Central Texas footprint that includes ... The satellite office for the region’s most established practice ... the South Austin, Buda, Kyle and San Marcos communities. ... fertility treatment directly to individuals and couples living in ...
(Date:9/23/2014)... (PRWEB) September 23, 2014 The ... a developer of cellular modems , platforms ... in the Startup category for the 2014 Tekne ... held at the Minneapolis Convention Center on Thursday, ... and individuals who have shown superior technology innovation ...
(Date:9/22/2014)... YORK and SANTA CLARA, Calif. ... Corp. (NASDAQ: WBMD ), the leading source ... new WebMD/Medscape survey that provide novel insights ... in aiding diagnosis and care.  Dr. Eric Topol ... and digital medicine, who serves as both Editor-in-Chief of ...
(Date:9/22/2014)... in a mouse model of pancreatic cancer identified distinct ... including significant differences from the primary tumor that may ... their study reported in the Sept. 25 issue of ... Hospital (MGH) Cancer Center identified several different classes of ... to be targets for improved treatment of the deadly ...
Breaking Biology Technology:Opening Doors to a Family: Texas Fertility Center Announces Newest Fertility Clinic in South Austin 2Opening Doors to a Family: Texas Fertility Center Announces Newest Fertility Clinic in South Austin 3NimbeLink Named Finalist for 15th Annual Tekne Awards 2NimbeLink Named Finalist for 15th Annual Tekne Awards 3WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 2WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 3WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 4Massachusetts General study reveals gene expression patterns in pancreatic CTCs 2Massachusetts General study reveals gene expression patterns in pancreatic CTCs 3
... (NASDAQ: NEOG ) announces the following Webcast:What: ... 26, 2011 @ 11:00 ETWhere: , How: ... on to the web at the address above.  Contact: ... are unable to participate during the live webcast, the ...
... ,   Elsevier, a ... services, today announced the,highlights of its journal Impact Factor ... ® ,published by Thomson Reuters, Elsevier saw over 55% ... while slightly over 49%,of non-Elsevier journals showed an increased ...
... ,   Executives from O2h ... agreement to substantially,increase the number of FTE chemists provided by ... Congreve, Head of Chemistry at Heptares said, "O2h has,been a ... our synthetic chemistry team to include a full lab unit ...
Cached Biology Technology:Elsevier Announces 2010 Journal Impact Factor Highlights 2Elsevier Announces 2010 Journal Impact Factor Highlights 3Oxygen Healthcare (O2h) Announces Expanded Chemistry Collaboration With Heptares Therapeutics 2
(Date:9/23/2014)... the development of animals and plants. The central problem ... translated in a reliable manner to give specific spatial ... of stripe formation is a classic paradigm in developmental ... the French flag, is caused by a gradient of ... low concentrations of the morphogen a "blue", "white" or ...
(Date:9/23/2014)... SPRINGS, Florida , September 23, 2014 ... for innovative companies in tech sector position for significant investor ... products & services.  Companies in focus today are: NXT-ID, Inc. ... BABA ), Mobileye N.V. (NYSE: MBLY ... Robotics Ltd. (NASDAQ: RWLK) NXT-ID, Inc. (NASDAQ: ...
(Date:9/22/2014)... Many native species have vanished from tropical islands ... scientists have discovered how fossils can be used ... lies in organic materials found in fossil bones, ... according to a new study available online and ... of Herpetology . Pre-human island ecosystems provide vital ...
Breaking Biology News(10 mins):Recreating the stripe patterns found in animals by engineering synthetic gene networks 2Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 2Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 3Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 4Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 5Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 6Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 7Answer to restoring lost island biodiversity found in fossils 2
... , HERNDON, Va., Dec. 15 The PTR ... announced that it has agreed to sponsor three high school teams ... ). , The PTR Group will provide funding ... teams from Atholton HS in Columbia, MD, Rockwall HS in Rockwall, ...
... often promoted as a clean-burning, renewable fuel that could help ... caused by ozone, compared with gasoline, especially in winter, according ... Ozone production from both gasoline and E85, a blend of ... in warm sunny weather than during the cold weather and ...
... 10, 2009If you are spending the holidays with big Uncle ... be better off with another family, spare a thought for ... McMaster University and the University of New South Wales has ... members make strategic decisions about their living situation. ...
Cached Biology News:The PTR Group Announces Financial and Technical Support to US FIRST Robotics Competition Teams 2Ethanol-powered vehicles generate more ozone than gas-powered ones 2Ethanol-powered vehicles generate more ozone than gas-powered ones 3
Mouse monoclonal antibody raised against a partial recombinant DENR. NCBI Entrez Gene ID = DENR...
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Biology Products: