Navigation Links
Ceres Announces Fiscal Third Quarter 2014 Financial Results
Date:7/10/2014

offers Persephone as an enterprise-grade client-server installation and is currently developing a Software as a Service (SaaS) model for individual researchers.
  • In June, the company announced that it had initiated field evaluations of a number of its leading biotech traits in sugarcane.
  • Financial Results
    Total revenues decreased by $0.5 million to $0.8 million for the quarter ended May 31, 2014 compared to the quarter ended May 31, 2013. Collaborative research and government grant revenue decreased by $0.3 million. Product sales decreased by $0.2 million, primarily due to reduced biomass sales, which resulted from changes and reductions in the company's sales incentive and promotional programs for the 2013-2014 sorghum growing season in Brazil.

    Cost of product sales decreased by $1.6 million to $0.6 million for the three months ended May 31, 2014 compared to the same period in the prior year. The decrease was primarily due to reduced expenses of $1.0 million resulting from changes and reductions in the company's sales incentive and promotional programs for the 2013-2014 sorghum growing season in Brazil and reduced expenses of $0.6 million related to obsolete seed inventory.

    Research and development expenses decreased by $0.5 million to $3.6 million for the three months ended May 31, 2014 compared to the same period in the prior year primarily due to reduced external research and development expenses in the United States.

    Selling, general and administrative expenses decreased by $0.6 million to $3.9 million for the three months ended May 31, 2014 compared to the same period in the prior year. In the U.S. personnel and related expenses and professional fees decreased by $0.5 million. In Brazil, personal and related expenses decreased by $0.1 million.

    For the quarter ended May 31, 2014, Ceres reported a net loss of $7.7 million, or $0.17 per share, compared to a net loss of $9.3 million, or $0.38 per share, for the
    '/>"/>

    SOURCE Ceres, Inc.
    Copyright©2014 PR Newswire.
    All rights reserved

    Page: 1 2 3 4 5 6 7 8 9

    Related biology technology :

    1. Ceres Expands Board of Directors with former BP Chief Scientist and Undersecretary of Energy Steven Koonin
    2. Ceres Receives $3.5 million from USAID for Trait Stacks
    3. Ceres and Syngenta to Collaborate on Sweet Sorghum Market Development
    4. Ceres Announces Webcast of Fiscal Year 2013 Financial Results
    5. Ceres Announces Fiscal Year 2013 Financial Results
    6. Ceres Announces Fiscal First Quarter 2014 Financial Results
    7. Keryx Biopharmaceuticals, Inc. Announces Upcoming Poster Presentations of Zerenex™ (Ferric Citrate) at the Upcoming American Society of Nephrology Kidney Week 2011 Annual Meeting
    8. VaxyGen Assay Services, LLC Announces Launch of Custom Bioassay Services and Operations
    9. Sequenom Announces Participation at the Lazard Capital Markets 8th Annual Healthcare Conference
    10. ACORN Research, LLC Announces Partnership with AdeptBio, LLC
    11. GeoVax Labs, Inc. Announces Nine Month 2011 Financial Results
    Post Your Comments:
    *Name:
    *Comment:
    *Email:
    (Date:8/28/2014)... 2014 SPIE Fellow Glenn Boreman, Professor ... Science and Director of the Center for Optoelectronics and ... Charlotte, and co-founder and Chairman of the Board of ... 2015 Vice President of SPIE, the international society for ... announced recent election results at the Annual General Meeting ...
    (Date:8/28/2014)... A new research platform uses a ... tiny structures undergoing stress and heating, an ... designs for microelectronics and batteries., This new ... about how heating and the surface stress ... Researchers have discussed the merits of surface-stress ...
    (Date:8/28/2014)... BOSTON , Aug. 28, 2014  Next month, executives ... at three key industry events beginning with Patient-Centered Clinical ... Hotel in Boston , September 4-5. Patient ... , and Aaron Fleishman will share insights on ... how a variety of tactics – from media to mobile ...
    (Date:8/28/2014)... Florida State University research team has led to a ... white light, and convert photon energy directly to mechanical ... , Biwu Ma, associate professor in the Department of ... Engineering, created the molecule in a lab about a ... creation has many other unique capabilities. , For example, ...
    Breaking Biology Technology:Glenn Boreman, UNC Professor and Plasmonics Co-Founder, Elected to SPIE Presidential Chain 2New analytical technology reveals 'nanomechanical' surface traits 2New analytical technology reveals 'nanomechanical' surface traits 3BBK Worldwide Leads Sessions at Key September Events 2Novel 'butterfly' molecule could build new sensors, photoenergy conversion devices 2
    ... ... January 22 , - First-Ever Young Women ... Elsevier announced today the winners of the Asian Young ... and citation database of peer-reviewed literature,and the Third World Organisation for Women in ...
    ... LEXINGTON, Mass. , and HEIDELBERG, Germany , ... at Children,s Hospital Boston chose febit,s HybSelect technology which will ... of genes of interest for resequencing. In January the core ... to perform HybSelect. , "We feel that febit,s HybSelect technology ...
    ... ... product offering, PrescriberPRO Mobile. ,PrescriberPRO Mobile is a state-of-the-art smart phone application ... medical prescribers. The application will provide names, addresses, and other account information on ... ...
    Cached Biology Technology:Scopus(R), TWOWS and TWAS Announce Young Women Researcher Award Recipients in Asia 2Scopus(R), TWOWS and TWAS Announce Young Women Researcher Award Recipients in Asia 3Scopus(R), TWOWS and TWAS Announce Young Women Researcher Award Recipients in Asia 4Scopus(R), TWOWS and TWAS Announce Young Women Researcher Award Recipients in Asia 5Scopus(R), TWOWS and TWAS Announce Young Women Researcher Award Recipients in Asia 6Scopus(R), TWOWS and TWAS Announce Young Women Researcher Award Recipients in Asia 7Molecular Genetics Core Facility at Children's Hospital Boston Selects HybSelect from febit for Targeted Resequencing 2Molecular Genetics Core Facility at Children's Hospital Boston Selects HybSelect from febit for Targeted Resequencing 3Healthcare Data Solutions Announces New Mobile Application, PrescriberPRO Mobile 2Healthcare Data Solutions Announces New Mobile Application, PrescriberPRO Mobile 3
    (Date:8/29/2014)... from the University of Texas Medical Branch at Galveston has ... antibodies can completely protect monkeys against a lethal dose of ... time when the disease is severe. , Thomas Geisbert, professor ... Nature discussing advances in Ebola treatment research. The filoviruses ... most deadly of pathogens, with fatality rates of up to ...
    (Date:8/29/2014)... This news release is available in German . ... are key players in the natural nitrogen cycle on ... these specialist bacteria were thought to depend on nitrite ... scientists led by Holger Daims, a microbiologist at the ... can use hydrogen as an alternative source of energy. ...
    (Date:8/29/2014)... nucleus, chromosomal DNA is tightly bound to structural ... chromatin. Until about two decades ago, histones were ... material around which the glamorous DNA strands were ... appreciation for how DNA/histone interactions govern gene expression. ... studying the sequence of the genome from cancer ...
    Breaking Biology News(10 mins):Leading Ebola researcher at UTMB says there's an effective treatment for Ebola 2Hydrogen powers important nitrogen-transforming bacteria 2Hydrogen powers important nitrogen-transforming bacteria 3'K-to-M' histone mutations: How repressing the repressors may drive tissue-specific cancers 2'K-to-M' histone mutations: How repressing the repressors may drive tissue-specific cancers 3
    ... The bird enthusiast who chronicled the adventures of a ... of Telegraph Hill" knows most of the parrots by name, ... one bird from another. While it has been known for ... our day-to-day environment, the underlying neural mechanism has been less ...
    ... reduce age-related macular degeneration ,(AMD) which is the major cause ... the third cause of global blindness, according to,a study published ... There are two types of AMD, wet and dry. ... loss. A team of researchers across seven European,countries and co-ordinated ...
    ... New Zealand mud snail currently inhabits four of the five ... to a Penn State team of researchers. These tiny creatures ... food replacements for the native species. "These snails have an ... Levri, associate professor of biology at Penn State,s Altoona Campus. ...
    Cached Biology News:Distinguishing between 2 birds of a feather 2Distinguishing between 2 birds of a feather 3Eat oily fish at least once a week to protect your eyesight in old age 2Tiny invasive snail impacts Great Lakes, alters ecology 2Tiny invasive snail impacts Great Lakes, alters ecology 3
    Mouse monoclonal antibody raised against a partial recombinant DENR. NCBI Entrez Gene ID = DENR...
    Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
    ... raised against a partial recombinant NFKBIB. ... 145 a.a) partial recombinant protein with GST tag. ... Accession: BC015528 ... OMIM: 604495, GeneID: ...
    ... Mouse polyclonal antibody raised against a ... FES (AAH35357, 120 a.a. ~ 250 ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
    Biology Products: